BLASTX nr result
ID: Ophiopogon22_contig00005706
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00005706 (656 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247498.1| proline-, glutamic acid- and leucine-rich pr... 78 5e-13 ref|XP_020247497.1| proline-, glutamic acid- and leucine-rich pr... 78 5e-13 ref|XP_008807711.1| PREDICTED: proline-, glutamic acid- and leuc... 66 6e-09 ref|XP_019710746.1| PREDICTED: proline-, glutamic acid- and leuc... 61 4e-07 ref|XP_020677381.1| proline-, glutamic acid- and leucine-rich pr... 61 4e-07 gb|OVA09040.1| hypothetical protein BVC80_9097g108 [Macleaya cor... 61 4e-07 ref|XP_010939528.1| PREDICTED: proline-, glutamic acid- and leuc... 61 4e-07 ref|XP_020683452.1| proline-, glutamic acid- and leucine-rich pr... 59 2e-06 gb|PKU87166.1| hypothetical protein MA16_Dca006575 [Dendrobium c... 59 2e-06 >ref|XP_020247498.1| proline-, glutamic acid- and leucine-rich protein 1 isoform X2 [Asparagus officinalis] Length = 856 Score = 78.2 bits (191), Expect = 5e-13 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -2 Query: 124 PGKDPPPPLGGQLMSEASKQATKMLPRLLIPRVSTFMHCC 5 PGKDPPPPLGGQLMSEA +QATKMLP ++IPRVST MHCC Sbjct: 287 PGKDPPPPLGGQLMSEAFEQATKMLPGMIIPRVSTLMHCC 326 >ref|XP_020247497.1| proline-, glutamic acid- and leucine-rich protein 1 isoform X1 [Asparagus officinalis] gb|ONK56694.1| uncharacterized protein A4U43_C10F11740 [Asparagus officinalis] Length = 857 Score = 78.2 bits (191), Expect = 5e-13 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -2 Query: 124 PGKDPPPPLGGQLMSEASKQATKMLPRLLIPRVSTFMHCC 5 PGKDPPPPLGGQLMSEA +QATKMLP ++IPRVST MHCC Sbjct: 288 PGKDPPPPLGGQLMSEAFEQATKMLPGMIIPRVSTLMHCC 327 >ref|XP_008807711.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1 [Phoenix dactylifera] Length = 882 Score = 66.2 bits (160), Expect = 6e-09 Identities = 31/42 (73%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -2 Query: 124 PGKDPPPPLGGQLMSE-ASKQATKMLPRLLIPRVSTFMHCCC 2 PGKDPPPPLGG L SE AS+ ATK+L LL+P VST MHCCC Sbjct: 285 PGKDPPPPLGGHLGSEEASQPATKVLHALLVPTVSTLMHCCC 326 >ref|XP_019710746.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1 isoform X2 [Elaeis guineensis] Length = 789 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/42 (66%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = -2 Query: 124 PGKDPPPPLGGQLMSE-ASKQATKMLPRLLIPRVSTFMHCCC 2 PGKDP PPLGG L SE AS+ ATK+L +L+P VST +HCCC Sbjct: 174 PGKDPSPPLGGHLRSEEASQPATKVLHEVLVPIVSTLIHCCC 215 >ref|XP_020677381.1| proline-, glutamic acid- and leucine-rich protein 1-like [Dendrobium catenatum] gb|PKU83639.1| hypothetical protein MA16_Dca020856 [Dendrobium catenatum] Length = 873 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -2 Query: 124 PGKDPPPPLGGQ-LMSEASKQATKMLPRLLIPRVSTFMHCCC 2 PGKDPPPPLGGQ L EA + AT+ L LL+PRV+T MH CC Sbjct: 285 PGKDPPPPLGGQTLPGEAFEPATRRLSELLVPRVTTLMHSCC 326 >gb|OVA09040.1| hypothetical protein BVC80_9097g108 [Macleaya cordata] Length = 877 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = -2 Query: 124 PGKDPPPPLGGQLMSEASKQATKMLPRLLIPRVSTFMHCCC 2 PGKDPPPPLGGQL E S QA +LL+ RVST M CCC Sbjct: 287 PGKDPPPPLGGQLSVETSDQAANRSEQLLLSRVSTLMFCCC 327 >ref|XP_010939528.1| PREDICTED: proline-, glutamic acid- and leucine-rich protein 1 isoform X1 [Elaeis guineensis] Length = 900 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/42 (66%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = -2 Query: 124 PGKDPPPPLGGQLMSE-ASKQATKMLPRLLIPRVSTFMHCCC 2 PGKDP PPLGG L SE AS+ ATK+L +L+P VST +HCCC Sbjct: 285 PGKDPSPPLGGHLRSEEASQPATKVLHEVLVPIVSTLIHCCC 326 >ref|XP_020683452.1| proline-, glutamic acid- and leucine-rich protein 1-like [Dendrobium catenatum] Length = 852 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/42 (64%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -2 Query: 124 PGKDPPPPLGGQ-LMSEASKQATKMLPRLLIPRVSTFMHCCC 2 PGKDPPPPLGGQ L EA + AT+ L LL+PRV+ MH CC Sbjct: 276 PGKDPPPPLGGQTLPGEAFEPATRRLSELLVPRVTALMHSCC 317 >gb|PKU87166.1| hypothetical protein MA16_Dca006575 [Dendrobium catenatum] Length = 866 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/42 (64%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = -2 Query: 124 PGKDPPPPLGGQ-LMSEASKQATKMLPRLLIPRVSTFMHCCC 2 PGKDPPPPLGGQ L EA + AT+ L LL+PRV+ MH CC Sbjct: 290 PGKDPPPPLGGQTLPGEAFEPATRRLSELLVPRVTALMHSCC 331