BLASTX nr result
ID: Ophiopogon22_contig00005171
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00005171 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFG71558.1| hypothetical protein 0_7735_02, partial [Pinus ta... 97 2e-23 gb|AEW07639.1| hypothetical protein 0_7735_02, partial [Pinus la... 97 2e-23 gb|AEW07638.1| hypothetical protein 0_7735_02, partial [Pinus ra... 96 3e-23 ref|XP_017251771.1| PREDICTED: histone H2B-like [Daucus carota s... 97 3e-23 ref|XP_017231400.1| PREDICTED: probable histone H2B.1 [Daucus ca... 97 4e-23 ref|XP_013616429.1| PREDICTED: histone H2B.7-like [Brassica oler... 97 4e-23 emb|CDY09241.1| BnaA02g06670D [Brassica napus] 97 4e-23 ref|XP_018462477.1| PREDICTED: histone H2B.7 [Raphanus sativus] 97 4e-23 ref|XP_018467984.1| PREDICTED: histone H2B.7-like [Raphanus sati... 97 4e-23 ref|XP_018478084.1| PREDICTED: histone H2B.3-like [Raphanus sati... 97 6e-23 ref|XP_013680989.1| histone H2B.7-like [Brassica napus] 96 6e-23 gb|KFK27531.1| hypothetical protein AALP_AA8G395500 [Arabis alpina] 96 7e-23 ref|XP_012838584.1| PREDICTED: probable histone H2B.1 [Erythrant... 96 8e-23 ref|XP_020243676.1| histone H2B.3 [Asparagus officinalis] 95 9e-23 ref|XP_013625457.1| PREDICTED: histone H2B.10-like [Brassica ole... 96 1e-22 gb|KCW52702.1| hypothetical protein EUGRSUZ_J02067 [Eucalyptus g... 95 1e-22 ref|XP_020268042.1| histone H2B.3 [Asparagus officinalis] 94 1e-22 gb|ABK22321.1| unknown [Picea sitchensis] 96 1e-22 ref|XP_018452828.1| PREDICTED: histone H2B.7-like [Raphanus sati... 96 1e-22 ref|XP_013724039.1| histone H2B.10-like [Brassica napus] 96 1e-22 >gb|AFG71558.1| hypothetical protein 0_7735_02, partial [Pinus taeda] gb|AFG71559.1| hypothetical protein 0_7735_02, partial [Pinus taeda] gb|AFG71560.1| hypothetical protein 0_7735_02, partial [Pinus taeda] gb|AFG71561.1| hypothetical protein 0_7735_02, partial [Pinus taeda] gb|AFG71562.1| hypothetical protein 0_7735_02, partial [Pinus taeda] gb|AFG71563.1| hypothetical protein 0_7735_02, partial [Pinus taeda] gb|AFG71564.1| hypothetical protein 0_7735_02, partial [Pinus taeda] gb|AFG71565.1| hypothetical protein 0_7735_02, partial [Pinus taeda] gb|AFG71566.1| hypothetical protein 0_7735_02, partial [Pinus taeda] gb|AFG71567.1| hypothetical protein 0_7735_02, partial [Pinus taeda] gb|AFG71568.1| hypothetical protein 0_7735_02, partial [Pinus taeda] gb|AFG71569.1| hypothetical protein 0_7735_02, partial [Pinus taeda] gb|AFG71570.1| hypothetical protein 0_7735_02, partial [Pinus taeda] gb|AFG71571.1| hypothetical protein 0_7735_02, partial [Pinus taeda] Length = 113 Score = 96.7 bits (239), Expect = 2e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEAS+LA Sbjct: 44 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASKLA 92 >gb|AEW07639.1| hypothetical protein 0_7735_02, partial [Pinus lambertiana] Length = 114 Score = 96.7 bits (239), Expect = 2e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEAS+LA Sbjct: 45 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASKLA 93 >gb|AEW07638.1| hypothetical protein 0_7735_02, partial [Pinus radiata] Length = 113 Score = 96.3 bits (238), Expect = 3e-23 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPD+GISSKAMGIMNSFINDIFEKLAGEAS+LA Sbjct: 44 SVETYKIYIFKVLKQVHPDVGISSKAMGIMNSFINDIFEKLAGEASKLA 92 >ref|XP_017251771.1| PREDICTED: histone H2B-like [Daucus carota subsp. sativus] gb|KZM95652.1| hypothetical protein DCAR_018894 [Daucus carota subsp. sativus] Length = 137 Score = 96.7 bits (239), Expect = 3e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEAS+LA Sbjct: 46 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASKLA 94 >ref|XP_017231400.1| PREDICTED: probable histone H2B.1 [Daucus carota subsp. sativus] gb|KZN05292.1| hypothetical protein DCAR_006129 [Daucus carota subsp. sativus] Length = 142 Score = 96.7 bits (239), Expect = 4e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEAS+LA Sbjct: 51 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASKLA 99 >ref|XP_013616429.1| PREDICTED: histone H2B.7-like [Brassica oleracea var. oleracea] ref|XP_013652943.1| histone H2B.7-like [Brassica napus] Length = 142 Score = 96.7 bits (239), Expect = 4e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEAS+LA Sbjct: 51 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASKLA 99 >emb|CDY09241.1| BnaA02g06670D [Brassica napus] Length = 142 Score = 96.7 bits (239), Expect = 4e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEAS+LA Sbjct: 51 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASKLA 99 >ref|XP_018462477.1| PREDICTED: histone H2B.7 [Raphanus sativus] Length = 146 Score = 96.7 bits (239), Expect = 4e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEAS+LA Sbjct: 55 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASKLA 103 >ref|XP_018467984.1| PREDICTED: histone H2B.7-like [Raphanus sativus] Length = 146 Score = 96.7 bits (239), Expect = 4e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEAS+LA Sbjct: 55 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASKLA 103 >ref|XP_018478084.1| PREDICTED: histone H2B.3-like [Raphanus sativus] Length = 154 Score = 96.7 bits (239), Expect = 6e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEAS+LA Sbjct: 63 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASKLA 111 >ref|XP_013680989.1| histone H2B.7-like [Brassica napus] Length = 142 Score = 96.3 bits (238), Expect = 6e-23 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEAS+LA Sbjct: 51 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASKLA 99 >gb|KFK27531.1| hypothetical protein AALP_AA8G395500 [Arabis alpina] Length = 150 Score = 96.3 bits (238), Expect = 7e-23 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEAS+LA Sbjct: 59 SIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASKLA 107 >ref|XP_012838584.1| PREDICTED: probable histone H2B.1 [Erythranthe guttata] gb|EYU36125.1| hypothetical protein MIMGU_mgv1a015485mg [Erythranthe guttata] Length = 156 Score = 96.3 bits (238), Expect = 8e-23 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIG+SSKAMGIMNSFINDIFEKLAGE+SRLA Sbjct: 65 SVETYKIYIFKVLKQVHPDIGVSSKAMGIMNSFINDIFEKLAGESSRLA 113 >ref|XP_020243676.1| histone H2B.3 [Asparagus officinalis] Length = 109 Score = 94.7 bits (234), Expect = 9e-23 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLA EASRLA Sbjct: 18 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLA 66 >ref|XP_013625457.1| PREDICTED: histone H2B.10-like [Brassica oleracea var. oleracea] ref|XP_013625458.1| PREDICTED: histone H2B.10-like [Brassica oleracea var. oleracea] Length = 136 Score = 95.5 bits (236), Expect = 1e-22 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGE+S+LA Sbjct: 45 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGESSKLA 93 >gb|KCW52702.1| hypothetical protein EUGRSUZ_J02067 [Eucalyptus grandis] Length = 112 Score = 94.7 bits (234), Expect = 1e-22 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLA EASRLA Sbjct: 21 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLA 69 >ref|XP_020268042.1| histone H2B.3 [Asparagus officinalis] Length = 101 Score = 94.4 bits (233), Expect = 1e-22 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIG+SSKAMGIMNSFINDIFEKLA EASRLA Sbjct: 10 SVETYKIYIFKVLKQVHPDIGVSSKAMGIMNSFINDIFEKLAHEASRLA 58 >gb|ABK22321.1| unknown [Picea sitchensis] Length = 140 Score = 95.5 bits (236), Expect = 1e-22 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLA EASRLA Sbjct: 49 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASEASRLA 97 >ref|XP_018452828.1| PREDICTED: histone H2B.7-like [Raphanus sativus] Length = 141 Score = 95.5 bits (236), Expect = 1e-22 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGE+S+LA Sbjct: 50 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGESSKLA 98 >ref|XP_013724039.1| histone H2B.10-like [Brassica napus] Length = 141 Score = 95.5 bits (236), Expect = 1e-22 Identities = 47/49 (95%), Positives = 49/49 (100%) Frame = +3 Query: 222 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASRLA 368 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGE+S+LA Sbjct: 50 SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGESSKLA 98