BLASTX nr result
ID: Ophiopogon22_contig00005047
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00005047 (371 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252479.1| transcription initiation factor IIA subunit ... 67 1e-10 ref|XP_020587440.1| LOW QUALITY PROTEIN: transcription initiatio... 67 3e-10 ref|XP_016503520.1| PREDICTED: transcription initiation factor I... 62 4e-10 gb|ERN08011.1| hypothetical protein AMTR_s00012p00256750 [Ambore... 64 4e-10 gb|PRQ30936.1| putative transcription factor IIA, alpha/beta sub... 61 5e-10 gb|POE95431.1| transcription initiation factor iia subunit 1 [Qu... 62 1e-09 ref|XP_016577757.1| PREDICTED: transcription initiation factor I... 64 2e-09 ref|XP_020242432.1| transcription initiation factor IIA large su... 64 2e-09 ref|XP_020242431.1| transcription initiation factor IIA large su... 64 2e-09 gb|PHT46736.1| Transcription initiation factor IIA subunit 1 [Ca... 64 2e-09 ref|XP_016577755.1| PREDICTED: transcription initiation factor I... 64 2e-09 ref|XP_016577754.1| PREDICTED: transcription initiation factor I... 64 2e-09 ref|XP_004241212.1| PREDICTED: transcription initiation factor I... 64 2e-09 ref|XP_016577753.1| PREDICTED: transcription initiation factor I... 64 2e-09 ref|XP_006350788.1| PREDICTED: transcription initiation factor I... 64 2e-09 gb|ABD33142.1| Transcription factor IIA, beta-barrel [Medicago t... 62 2e-09 gb|PNY09347.1| transcription initiation factor IIA large subunit... 64 2e-09 ref|XP_008801612.1| PREDICTED: transcription initiation factor I... 64 2e-09 ref|XP_011624137.1| transcription initiation factor IIA large su... 64 2e-09 ref|XP_009409507.1| PREDICTED: transcription initiation factor I... 64 2e-09 >ref|XP_020252479.1| transcription initiation factor IIA subunit 1-like [Asparagus officinalis] gb|ONK76902.1| uncharacterized protein A4U43_C02F1080 [Asparagus officinalis] Length = 386 Score = 67.4 bits (163), Expect = 1e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMHL SRDILFNKANGEFDF Sbjct: 356 KSRWKCTLKDGIMHLNSRDILFNKANGEFDF 386 >ref|XP_020587440.1| LOW QUALITY PROTEIN: transcription initiation factor IIA large subunit-like [Phalaenopsis equestris] Length = 388 Score = 66.6 bits (161), Expect = 3e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMH+ SRDILFNKANGEFDF Sbjct: 358 KSRWKCTLKDGIMHINSRDILFNKANGEFDF 388 >ref|XP_016503520.1| PREDICTED: transcription initiation factor IIA subunit 1-like [Nicotiana tabacum] Length = 86 Score = 62.0 bits (149), Expect = 4e-10 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMH+ ++DILFNKA GEFDF Sbjct: 56 KSRWKCTLKDGIMHINNKDILFNKATGEFDF 86 >gb|ERN08011.1| hypothetical protein AMTR_s00012p00256750 [Amborella trichopoda] Length = 175 Score = 63.9 bits (154), Expect = 4e-10 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMHL S+DILF KANGEFDF Sbjct: 145 KSRWKCTLKDGIMHLNSKDILFTKANGEFDF 175 >gb|PRQ30936.1| putative transcription factor IIA, alpha/beta subunit [Rosa chinensis] Length = 60 Score = 60.8 bits (146), Expect = 5e-10 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KS+WKCTLKDGIMH+ +RDILFNKA G+FDF Sbjct: 30 KSKWKCTLKDGIMHMNNRDILFNKATGDFDF 60 >gb|POE95431.1| transcription initiation factor iia subunit 1 [Quercus suber] Length = 149 Score = 62.0 bits (149), Expect = 1e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMH+ ++DILFNKA GEFDF Sbjct: 119 KSRWKCTLKDGIMHINNKDILFNKATGEFDF 149 >ref|XP_016577757.1| PREDICTED: transcription initiation factor IIA large subunit isoform X4 [Capsicum annuum] Length = 361 Score = 64.3 bits (155), Expect = 2e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMH+ ++DILFNKANGEFDF Sbjct: 331 KSRWKCTLKDGIMHINNKDILFNKANGEFDF 361 >ref|XP_020242432.1| transcription initiation factor IIA large subunit-like isoform X2 [Asparagus officinalis] gb|ONK61976.1| uncharacterized protein A4U43_C08F35530 [Asparagus officinalis] Length = 375 Score = 64.3 bits (155), Expect = 2e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 K+RWKCTLKDGIMHL SRD+LFNKANGEF+F Sbjct: 345 KNRWKCTLKDGIMHLNSRDVLFNKANGEFEF 375 >ref|XP_020242431.1| transcription initiation factor IIA large subunit-like isoform X1 [Asparagus officinalis] Length = 384 Score = 64.3 bits (155), Expect = 2e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 K+RWKCTLKDGIMHL SRD+LFNKANGEF+F Sbjct: 354 KNRWKCTLKDGIMHLNSRDVLFNKANGEFEF 384 >gb|PHT46736.1| Transcription initiation factor IIA subunit 1 [Capsicum baccatum] gb|PHU16120.1| Transcription initiation factor IIA subunit 1 [Capsicum chinense] Length = 400 Score = 64.3 bits (155), Expect = 2e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMH+ ++DILFNKANGEFDF Sbjct: 370 KSRWKCTLKDGIMHINNKDILFNKANGEFDF 400 >ref|XP_016577755.1| PREDICTED: transcription initiation factor IIA large subunit isoform X3 [Capsicum annuum] gb|PHT80227.1| hypothetical protein T459_18279 [Capsicum annuum] Length = 400 Score = 64.3 bits (155), Expect = 2e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMH+ ++DILFNKANGEFDF Sbjct: 370 KSRWKCTLKDGIMHINNKDILFNKANGEFDF 400 >ref|XP_016577754.1| PREDICTED: transcription initiation factor IIA large subunit isoform X2 [Capsicum annuum] Length = 401 Score = 64.3 bits (155), Expect = 2e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMH+ ++DILFNKANGEFDF Sbjct: 371 KSRWKCTLKDGIMHINNKDILFNKANGEFDF 401 >ref|XP_004241212.1| PREDICTED: transcription initiation factor IIA large subunit [Solanum lycopersicum] ref|XP_015079667.1| PREDICTED: transcription initiation factor IIA large subunit [Solanum pennellii] Length = 401 Score = 64.3 bits (155), Expect = 2e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMH+ ++DILFNKANGEFDF Sbjct: 371 KSRWKCTLKDGIMHINNKDILFNKANGEFDF 401 >ref|XP_016577753.1| PREDICTED: transcription initiation factor IIA large subunit isoform X1 [Capsicum annuum] Length = 402 Score = 64.3 bits (155), Expect = 2e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMH+ ++DILFNKANGEFDF Sbjct: 372 KSRWKCTLKDGIMHINNKDILFNKANGEFDF 402 >ref|XP_006350788.1| PREDICTED: transcription initiation factor IIA large subunit [Solanum tuberosum] Length = 403 Score = 64.3 bits (155), Expect = 2e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMH+ ++DILFNKANGEFDF Sbjct: 373 KSRWKCTLKDGIMHINNKDILFNKANGEFDF 403 >gb|ABD33142.1| Transcription factor IIA, beta-barrel [Medicago truncatula] Length = 140 Score = 61.6 bits (148), Expect = 2e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMH+ +DILFNKA GEFDF Sbjct: 110 KSRWKCTLKDGIMHINKKDILFNKATGEFDF 140 >gb|PNY09347.1| transcription initiation factor IIA large subunit-like protein [Trifolium pratense] Length = 449 Score = 64.3 bits (155), Expect = 2e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMH+ ++DILFNKANGEFDF Sbjct: 419 KSRWKCTLKDGIMHINNKDILFNKANGEFDF 449 >ref|XP_008801612.1| PREDICTED: transcription initiation factor IIA subunit 1-like [Phoenix dactylifera] Length = 374 Score = 63.9 bits (154), Expect = 2e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMHL +RDILFNKA GEFDF Sbjct: 344 KSRWKCTLKDGIMHLNNRDILFNKATGEFDF 374 >ref|XP_011624137.1| transcription initiation factor IIA large subunit [Amborella trichopoda] Length = 375 Score = 63.9 bits (154), Expect = 2e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMHL S+DILF KANGEFDF Sbjct: 345 KSRWKCTLKDGIMHLNSKDILFTKANGEFDF 375 >ref|XP_009409507.1| PREDICTED: transcription initiation factor IIA subunit 1 [Musa acuminata subsp. malaccensis] Length = 382 Score = 63.9 bits (154), Expect = 2e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 369 KSRWKCTLKDGIMHLYSRDILFNKANGEFDF 277 KSRWKCTLKDGIMHL +RDILFNKA GEFDF Sbjct: 352 KSRWKCTLKDGIMHLNNRDILFNKATGEFDF 382