BLASTX nr result
ID: Ophiopogon22_contig00004915
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00004915 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241746.1| uncharacterized protein LOC109820088 [Aspara... 72 1e-13 ref|XP_020702789.1| uncharacterized protein LOC110114295 [Dendro... 52 2e-08 >ref|XP_020241746.1| uncharacterized protein LOC109820088 [Asparagus officinalis] gb|ONK60779.1| uncharacterized protein A4U43_C08F22520 [Asparagus officinalis] Length = 1033 Score = 72.4 bits (176), Expect(2) = 1e-13 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +3 Query: 141 MTPVIHCSAGNIHFFPRATLIQRKEIQLTKHNVSGHCNRL 260 MTPVIHCS GNIHFFPRAT RKEIQLTKHN++G+ NRL Sbjct: 1 MTPVIHCSTGNIHFFPRATFTTRKEIQLTKHNINGNHNRL 40 Score = 31.2 bits (69), Expect(2) = 1e-13 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = +2 Query: 323 AVGADVTVEETNPAVSGEDADK 388 AV ADVTVEE N +VS EDA+K Sbjct: 77 AVRADVTVEEPNLSVSVEDAEK 98 >ref|XP_020702789.1| uncharacterized protein LOC110114295 [Dendrobium catenatum] ref|XP_020702790.1| uncharacterized protein LOC110114295 [Dendrobium catenatum] gb|PKU72389.1| Elongation factor Ts, chloroplastic [Dendrobium catenatum] Length = 1204 Score = 52.4 bits (124), Expect(2) = 2e-08 Identities = 24/41 (58%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = +3 Query: 141 MTPVIHCSAGNIHFFPRATLIQRKEIQLTKHNVS-GHCNRL 260 M+P+IHCS GNI+ FP AT +Q K IQLTK+N S H R+ Sbjct: 1 MSPLIHCSIGNINLFPGATFVQTKRIQLTKYNASHNHAERV 41 Score = 33.5 bits (75), Expect(2) = 2e-08 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +2 Query: 323 AVGADVTVEETNPAVSGE 376 AVG DVTVE+ NPAVSGE Sbjct: 76 AVGTDVTVEDPNPAVSGE 93