BLASTX nr result
ID: Ophiopogon22_contig00003438
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00003438 (3316 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265803.1| tubby-like protein 4 isoform X2 [Asparagus o... 62 1e-06 ref|XP_020265802.1| tubby-like protein 4 isoform X1 [Asparagus o... 62 1e-06 >ref|XP_020265803.1| tubby-like protein 4 isoform X2 [Asparagus officinalis] Length = 263 Score = 62.4 bits (150), Expect = 1e-06 Identities = 30/51 (58%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -1 Query: 2059 APATSWSILPNWSLLRRP--SNAGKCTCIIVKESVQGANGMSMSLYSLYSN 1913 APA+SWS LPN SLL RP + G+C+C+IVKE V+ G++MSLYSL +N Sbjct: 10 APASSWSTLPNRSLLCRPLPMDVGRCSCVIVKERVEAVKGVTMSLYSLCTN 60 >ref|XP_020265802.1| tubby-like protein 4 isoform X1 [Asparagus officinalis] gb|ONK70496.1| uncharacterized protein A4U43_C05F34310 [Asparagus officinalis] Length = 281 Score = 62.4 bits (150), Expect = 1e-06 Identities = 30/51 (58%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -1 Query: 2059 APATSWSILPNWSLLRRP--SNAGKCTCIIVKESVQGANGMSMSLYSLYSN 1913 APA+SWS LPN SLL RP + G+C+C+IVKE V+ G++MSLYSL +N Sbjct: 10 APASSWSTLPNRSLLCRPLPMDVGRCSCVIVKERVEAVKGVTMSLYSLCTN 60