BLASTX nr result
ID: Ophiopogon22_contig00003331
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00003331 (694 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019706752.1| PREDICTED: probable tetraacyldisaccharide 4'... 57 9e-06 ref|XP_008808430.1| PREDICTED: probable tetraacyldisaccharide 4'... 57 1e-05 ref|XP_008808429.1| PREDICTED: probable tetraacyldisaccharide 4'... 57 1e-05 >ref|XP_019706752.1| PREDICTED: probable tetraacyldisaccharide 4'-kinase, mitochondrial isoform X3 [Elaeis guineensis] Length = 326 Score = 56.6 bits (135), Expect = 9e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +2 Query: 581 LILEGYAVGDEAKMLHRHLLLTSARLGVGANRRAITAS 694 ++ GY+ GDEAKMLHRHLL TSAR+GVGANR A AS Sbjct: 98 ILTRGYSGGDEAKMLHRHLLQTSARIGVGANRIATAAS 135 >ref|XP_008808430.1| PREDICTED: probable tetraacyldisaccharide 4'-kinase, mitochondrial isoform X4 [Phoenix dactylifera] Length = 378 Score = 56.6 bits (135), Expect = 1e-05 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +2 Query: 581 LILEGYAVGDEAKMLHRHLLLTSARLGVGANRRAITAS 694 ++ GY+ GDEAKMLHRHLL TSAR+GVGANR A AS Sbjct: 98 ILTRGYSGGDEAKMLHRHLLQTSARIGVGANRIATAAS 135 >ref|XP_008808429.1| PREDICTED: probable tetraacyldisaccharide 4'-kinase, mitochondrial isoform X3 [Phoenix dactylifera] Length = 380 Score = 56.6 bits (135), Expect = 1e-05 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +2 Query: 581 LILEGYAVGDEAKMLHRHLLLTSARLGVGANRRAITAS 694 ++ GY+ GDEAKMLHRHLL TSAR+GVGANR A AS Sbjct: 98 ILTRGYSGGDEAKMLHRHLLQTSARIGVGANRIATAAS 135