BLASTX nr result
ID: Ophiopogon22_contig00002795
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00002795 (716 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008236750.1| PREDICTED: uncharacterized protein LOC103335... 60 6e-07 >ref|XP_008236750.1| PREDICTED: uncharacterized protein LOC103335514 [Prunus mume] Length = 411 Score = 60.5 bits (145), Expect = 6e-07 Identities = 37/82 (45%), Positives = 47/82 (57%), Gaps = 2/82 (2%) Frame = +2 Query: 35 NKISELEREN--FQLNLPQKTIQQAFPPAQNNEDKMGGHSLMNVIRGSVEPKISTPSPSQ 208 NKI LE +N QL L Q F P + +MGG ++ R S K +P PSQ Sbjct: 153 NKILFLEEQNRQTQLQLHLAQTQARFIPLPHRSGQMGGDFPVSFNRVSETAKTVSPGPSQ 212 Query: 209 TADGKGNSSPFIAEALSKSLQE 274 T DGKG+S+P +AEAL KSLQ+ Sbjct: 213 TVDGKGSSNPLMAEALPKSLQQ 234