BLASTX nr result
ID: Ophiopogon22_contig00002699
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00002699 (1913 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB76743.1| hypothetical protein B456_012G104600 [Gossypium r... 60 2e-07 gb|KJB16392.1| hypothetical protein B456_002G228400 [Gossypium r... 60 4e-07 gb|KJB76633.1| hypothetical protein B456_012G100600 [Gossypium r... 59 9e-07 gb|PPE01412.1| hypothetical protein GOBAR_DD01555 [Gossypium bar... 58 8e-06 ref|XP_020110196.1| 60S ribosomal protein L6-like isoform X2 [An... 58 9e-06 ref|XP_010943581.1| PREDICTED: 60S ribosomal protein L6 [Elaeis ... 58 9e-06 >gb|KJB76743.1| hypothetical protein B456_012G104600 [Gossypium raimondii] Length = 90 Score = 59.7 bits (143), Expect = 2e-07 Identities = 36/59 (61%), Positives = 39/59 (66%), Gaps = 5/59 (8%) Frame = +1 Query: 1 VLILLAGRFMGKRVVFLKQLPSGLLLVTGDISFFAFVFWFVLDL-----Y*QYILIYKV 162 VLILLAGRFMGKRVVFLKQL SGLLLVTG F FV+DL Y Y + Y + Sbjct: 23 VLILLAGRFMGKRVVFLKQLTSGLLLVTGGHYIFYCYPCFVIDLLTALKYWMYDICYSI 81 >gb|KJB16392.1| hypothetical protein B456_002G228400 [Gossypium raimondii] Length = 140 Score = 60.1 bits (144), Expect = 4e-07 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +1 Query: 1 VLILLAGRFMGKRVVFLKQLPSGLLLVTGDISFFAFVFWFVLDL 132 VLILLAGRFMGKRVVFLKQL SGLLLVTG F +FV+DL Sbjct: 94 VLILLAGRFMGKRVVFLKQLTSGLLLVTGGHYIFYCYPFFVIDL 137 >gb|KJB76633.1| hypothetical protein B456_012G100600 [Gossypium raimondii] Length = 130 Score = 58.9 bits (141), Expect = 9e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 1 VLILLAGRFMGKRVVFLKQLPSGLLLVTGDISFF 102 VLILLAGRFMGKRVVFLKQL SGLLLVTG++ +F Sbjct: 94 VLILLAGRFMGKRVVFLKQLTSGLLLVTGELLYF 127 >gb|PPE01412.1| hypothetical protein GOBAR_DD01555 [Gossypium barbadense] Length = 193 Score = 57.8 bits (138), Expect = 8e-06 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 VLILLAGRFMGKRVVFLKQLPSGLLLVTG 87 VLILLAGRFMGKRVVFLKQLPSGLLLVTG Sbjct: 54 VLILLAGRFMGKRVVFLKQLPSGLLLVTG 82 >ref|XP_020110196.1| 60S ribosomal protein L6-like isoform X2 [Ananas comosus] gb|OAY63279.1| 60S ribosomal protein L6 [Ananas comosus] Length = 199 Score = 57.8 bits (138), Expect = 9e-06 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 VLILLAGRFMGKRVVFLKQLPSGLLLVTG 87 VLILLAGRFMGKRVVFLKQLPSGLLLVTG Sbjct: 94 VLILLAGRFMGKRVVFLKQLPSGLLLVTG 122 >ref|XP_010943581.1| PREDICTED: 60S ribosomal protein L6 [Elaeis guineensis] Length = 202 Score = 57.8 bits (138), Expect = 9e-06 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 VLILLAGRFMGKRVVFLKQLPSGLLLVTG 87 VLILLAGRFMGKRVVFLKQLPSGLLLVTG Sbjct: 63 VLILLAGRFMGKRVVFLKQLPSGLLLVTG 91