BLASTX nr result
ID: Ophiopogon22_contig00002436
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00002436 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020255680.1| uncharacterized protein LOC109832685 [Aspara... 49 1e-07 >ref|XP_020255680.1| uncharacterized protein LOC109832685 [Asparagus officinalis] gb|ONK74012.1| uncharacterized protein A4U43_C03F1890 [Asparagus officinalis] Length = 291 Score = 48.9 bits (115), Expect(2) = 1e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -2 Query: 357 ITQDFLKLSKYAKLEVDLM*RWKMIFVHTQDGLVCEIAQT 238 +TQD KLSK +KLEVDLM W +IF TQ+ LV EIA+T Sbjct: 222 LTQDSSKLSKPSKLEVDLMQHWNLIFSRTQNALVHEIAKT 261 Score = 34.7 bits (78), Expect(2) = 1e-07 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 424 DTRG*LIELQRSKKRAGDQI 365 DTRG L ELQRSKKRA DQI Sbjct: 200 DTRGRLTELQRSKKRAADQI 219