BLASTX nr result
ID: Ophiopogon22_contig00002282
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00002282 (481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022857449.1| hypersensitive-induced response protein-like... 67 3e-11 ref|XP_022857448.1| hypersensitive-induced response protein-like... 67 4e-11 gb|POE52600.1| hypersensitive-induced response protein 1 [Quercu... 67 3e-10 gb|EYU35885.1| hypothetical protein MIMGU_mgv1a0125941mg, partia... 63 3e-10 dbj|GAV87848.1| Band_7 domain-containing protein [Cephalotus fol... 67 4e-10 gb|OWM65330.1| hypothetical protein CDL15_Pgr008920 [Punica gran... 67 5e-10 gb|OMO79990.1| Band 7 protein, partial [Corchorus olitorius] 62 6e-10 gb|KJB70936.1| hypothetical protein B456_011G096600 [Gossypium r... 66 6e-10 ref|XP_018831584.1| PREDICTED: hypersensitive-induced response p... 66 7e-10 gb|KJB70935.1| hypothetical protein B456_011G096600 [Gossypium r... 66 9e-10 gb|KJB70934.1| hypothetical protein B456_011G096600 [Gossypium r... 66 9e-10 ref|XP_022868827.1| hypersensitive-induced response protein-like... 63 9e-10 gb|OMO77436.1| Band 7 protein [Corchorus olitorius] 66 1e-09 ref|XP_010100924.1| hypersensitive-induced reaction 1 protein [M... 66 1e-09 ref|XP_010086580.1| hypersensitive-induced reaction 1 protein [M... 66 1e-09 ref|XP_012456393.1| PREDICTED: hypersensitive-induced response p... 66 1e-09 ref|XP_021616181.1| hypersensitive-induced response protein-like... 66 1e-09 ref|XP_011071605.1| hypersensitive-induced response protein 1 [S... 66 1e-09 gb|OMO79216.1| Band 7 protein [Corchorus capsularis] 66 1e-09 ref|XP_016678562.1| PREDICTED: hypersensitive-induced response p... 65 1e-09 >ref|XP_022857449.1| hypersensitive-induced response protein-like protein 1 isoform X2 [Olea europaea var. sylvestris] Length = 140 Score = 67.4 bits (163), Expect = 3e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG LLCCVQVDQSTVAIKE+FGKFDEVLEPGC Sbjct: 1 MGNLLCCVQVDQSTVAIKERFGKFDEVLEPGC 32 >ref|XP_022857448.1| hypersensitive-induced response protein-like protein 1 isoform X1 [Olea europaea var. sylvestris] Length = 150 Score = 67.4 bits (163), Expect = 4e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG LLCCVQVDQSTVAIKE+FGKFDEVLEPGC Sbjct: 11 MGNLLCCVQVDQSTVAIKERFGKFDEVLEPGC 42 >gb|POE52600.1| hypersensitive-induced response protein 1 [Quercus suber] Length = 288 Score = 67.4 bits (163), Expect = 3e-10 Identities = 39/81 (48%), Positives = 46/81 (56%) Frame = -1 Query: 244 CQLISWLLACLLSYKMSYCL*QIIILFFLVPLHIFSICSC*EKRVIG*IMGGLLCCVQVD 65 C + W L LS ++ L Q+ + C K+ MG LLCCVQVD Sbjct: 32 CHFLPWCLGSQLSGHLTLRLQQLDVR-----------CETRTKK-----MGNLLCCVQVD 75 Query: 64 QSTVAIKEKFGKFDEVLEPGC 2 QSTVAIKEKFGKF+EVLEPGC Sbjct: 76 QSTVAIKEKFGKFEEVLEPGC 96 Score = 67.0 bits (162), Expect = 4e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG LLCCVQVDQSTVAIKEKFGKF+EVLEPGC Sbjct: 1 MGNLLCCVQVDQSTVAIKEKFGKFEEVLEPGC 32 >gb|EYU35885.1| hypothetical protein MIMGU_mgv1a0125941mg, partial [Erythranthe guttata] Length = 65 Score = 62.8 bits (151), Expect = 3e-10 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG L CC+QVDQSTVAIKE+FGKF++VLEPGC Sbjct: 1 MGNLFCCIQVDQSTVAIKERFGKFEDVLEPGC 32 >dbj|GAV87848.1| Band_7 domain-containing protein [Cephalotus follicularis] Length = 285 Score = 67.0 bits (162), Expect = 4e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG LLCCVQVDQSTVAIKEKFGKF+EVLEPGC Sbjct: 1 MGNLLCCVQVDQSTVAIKEKFGKFEEVLEPGC 32 >gb|OWM65330.1| hypothetical protein CDL15_Pgr008920 [Punica granatum] gb|PKI63206.1| hypothetical protein CRG98_016391 [Punica granatum] Length = 286 Score = 66.6 bits (161), Expect = 5e-10 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MGG+LCC+QVDQSTVA+KE+FGKFDEVL+PGC Sbjct: 1 MGGVLCCIQVDQSTVAVKERFGKFDEVLQPGC 32 >gb|OMO79990.1| Band 7 protein, partial [Corchorus olitorius] Length = 63 Score = 62.0 bits (149), Expect = 6e-10 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG L CCVQVDQSTVAIKE+FG+F++VLEPGC Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGRFEDVLEPGC 32 >gb|KJB70936.1| hypothetical protein B456_011G096600 [Gossypium raimondii] Length = 234 Score = 65.9 bits (159), Expect = 6e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG L CCVQVDQSTVAIKE+FGKFDEVLEPGC Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDEVLEPGC 32 >ref|XP_018831584.1| PREDICTED: hypersensitive-induced response protein 1 [Juglans regia] ref|XP_018831585.1| PREDICTED: hypersensitive-induced response protein 1 [Juglans regia] ref|XP_018831586.1| PREDICTED: hypersensitive-induced response protein 1 [Juglans regia] Length = 285 Score = 66.2 bits (160), Expect = 7e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG LLCCVQVDQSTVAIKE+FGKFDEVL+PGC Sbjct: 1 MGNLLCCVQVDQSTVAIKERFGKFDEVLQPGC 32 >gb|KJB70935.1| hypothetical protein B456_011G096600 [Gossypium raimondii] Length = 274 Score = 65.9 bits (159), Expect = 9e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG L CCVQVDQSTVAIKE+FGKFDEVLEPGC Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDEVLEPGC 32 >gb|KJB70934.1| hypothetical protein B456_011G096600 [Gossypium raimondii] Length = 278 Score = 65.9 bits (159), Expect = 9e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG L CCVQVDQSTVAIKE+FGKFDEVLEPGC Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDEVLEPGC 32 >ref|XP_022868827.1| hypersensitive-induced response protein-like protein 1 [Olea europaea var. sylvestris] Length = 112 Score = 62.8 bits (151), Expect = 9e-10 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG L CCV+VDQSTVAI+E+FGKFDEVLEPGC Sbjct: 1 MGNLFCCVKVDQSTVAIREQFGKFDEVLEPGC 32 >gb|OMO77436.1| Band 7 protein [Corchorus olitorius] Length = 286 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG L CCVQVDQSTVAIKE+FGKFDEVLEPGC Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDEVLEPGC 32 >ref|XP_010100924.1| hypersensitive-induced reaction 1 protein [Morus notabilis] gb|EXB86236.1| Hypersensitive-induced response protein 1 [Morus notabilis] Length = 286 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG LLCCVQVDQSTVAIKE+FGKF+EVLEPGC Sbjct: 1 MGNLLCCVQVDQSTVAIKERFGKFEEVLEPGC 32 >ref|XP_010086580.1| hypersensitive-induced reaction 1 protein [Morus notabilis] ref|XP_024017411.1| hypersensitive-induced reaction 1 protein [Morus notabilis] gb|EXB20735.1| Hypersensitive-induced response protein 1 [Morus notabilis] Length = 286 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG LLCCVQVDQSTVAIKE+FGKF+EVLEPGC Sbjct: 1 MGNLLCCVQVDQSTVAIKERFGKFEEVLEPGC 32 >ref|XP_012456393.1| PREDICTED: hypersensitive-induced response protein 1-like [Gossypium raimondii] ref|XP_016698590.1| PREDICTED: hypersensitive-induced response protein 1-like [Gossypium hirsutum] ref|XP_016698591.1| PREDICTED: hypersensitive-induced response protein 1-like [Gossypium hirsutum] gb|KJB70933.1| hypothetical protein B456_011G096600 [Gossypium raimondii] gb|PPD93374.1| hypothetical protein GOBAR_DD09686 [Gossypium barbadense] Length = 286 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG L CCVQVDQSTVAIKE+FGKFDEVLEPGC Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDEVLEPGC 32 >ref|XP_021616181.1| hypersensitive-induced response protein-like protein 1 [Manihot esculenta] ref|XP_021616183.1| hypersensitive-induced response protein-like protein 1 [Manihot esculenta] ref|XP_021616184.1| hypersensitive-induced response protein-like protein 1 [Manihot esculenta] ref|XP_021616185.1| hypersensitive-induced response protein-like protein 1 [Manihot esculenta] gb|OAY47658.1| hypothetical protein MANES_06G095800 [Manihot esculenta] gb|OAY47659.1| hypothetical protein MANES_06G095800 [Manihot esculenta] gb|OAY47660.1| hypothetical protein MANES_06G095800 [Manihot esculenta] gb|OAY47661.1| hypothetical protein MANES_06G095800 [Manihot esculenta] gb|OAY47662.1| hypothetical protein MANES_06G095800 [Manihot esculenta] gb|OAY47663.1| hypothetical protein MANES_06G095800 [Manihot esculenta] Length = 287 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG L CCVQVDQSTVAIKE+FGKFDEVLEPGC Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDEVLEPGC 32 >ref|XP_011071605.1| hypersensitive-induced response protein 1 [Sesamum indicum] Length = 287 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG L CCVQVDQSTVAIKE+FGKFDEVLEPGC Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDEVLEPGC 32 >gb|OMO79216.1| Band 7 protein [Corchorus capsularis] Length = 289 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG L CCVQVDQSTVAIKE+FGKFDEVLEPGC Sbjct: 1 MGNLFCCVQVDQSTVAIKERFGKFDEVLEPGC 32 >ref|XP_016678562.1| PREDICTED: hypersensitive-induced response protein 1-like [Gossypium hirsutum] ref|XP_017648311.1| PREDICTED: hypersensitive-induced response protein 1-like [Gossypium arboreum] gb|KHG24180.1| Hypersensitive-induced response 1 -like protein [Gossypium arboreum] Length = 286 Score = 65.5 bits (158), Expect = 1e-09 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 97 MGGLLCCVQVDQSTVAIKEKFGKFDEVLEPGC 2 MG L CCVQVDQSTVA+KE+FGKFDEVLEPGC Sbjct: 1 MGNLFCCVQVDQSTVAVKERFGKFDEVLEPGC 32