BLASTX nr result
ID: Ophiopogon22_contig00002036
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00002036 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK63583.1| uncharacterized protein A4U43_C07F16750 [Asparagu... 57 7e-07 >gb|ONK63583.1| uncharacterized protein A4U43_C07F16750 [Asparagus officinalis] Length = 304 Score = 57.4 bits (137), Expect = 7e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -2 Query: 370 SDFRFGSPFNMPAMDFNDALPRGMGESLIPNQNNSNWFF 254 +DFRFGSPF++PAMDFN+A S+I NQNNSNWFF Sbjct: 272 ADFRFGSPFSVPAMDFNEA------SSMIANQNNSNWFF 304