BLASTX nr result
ID: Ophiopogon22_contig00001101
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00001101 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010914356.1| PREDICTED: centrosome-associated protein CEP... 55 6e-06 >ref|XP_010914356.1| PREDICTED: centrosome-associated protein CEP250-like [Elaeis guineensis] Length = 678 Score = 54.7 bits (130), Expect = 6e-06 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = -3 Query: 404 RSRVAKIEEMNRELKAMQKKAAEDAKKRKPGLLMWLYPATATVLAAIS 261 + RV KIE+M+RELK +Q + A+ KK GL WLYPAT TVLAAIS Sbjct: 625 KGRVGKIEDMSRELKVLQDEVAKAQKKG--GLQRWLYPATTTVLAAIS 670