BLASTX nr result
ID: Ophiopogon22_contig00001076
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00001076 (650 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020250595.1| uncharacterized protein LOC109827977 [Aspara... 87 9e-17 >ref|XP_020250595.1| uncharacterized protein LOC109827977 [Asparagus officinalis] Length = 300 Score = 87.0 bits (214), Expect = 9e-17 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -3 Query: 648 CAGVMYLCEFVADKDKTMPDFLKDAPKPKCQYLGHKEGLKQFMETIE 508 CAGVMYLCEFVADK+ MP+FLKDAPKPK +LG+KEGLKQFMETIE Sbjct: 219 CAGVMYLCEFVADKENKMPEFLKDAPKPKRHFLGYKEGLKQFMETIE 265