BLASTX nr result
ID: Ophiopogon22_contig00000995
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00000995 (449 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010262302.1| PREDICTED: RING-H2 finger protein ATL16-like... 88 8e-18 ref|XP_011029837.1| PREDICTED: RING-H2 finger protein ATL16-like... 86 9e-17 ref|XP_021675607.1| RING-H2 finger protein ATL16 [Hevea brasilie... 85 1e-16 ref|XP_021606970.1| RING-H2 finger protein ATL16-like [Manihot e... 85 2e-16 gb|PNT25063.1| hypothetical protein POPTR_008G165900v3 [Populus ... 85 2e-16 ref|XP_011030515.1| PREDICTED: RING-H2 finger protein ATL16-like... 85 2e-16 ref|XP_002314635.2| zinc finger family protein [Populus trichoca... 85 2e-16 ref|XP_020222727.1| RING-H2 finger protein ATL16 [Cajanus cajan] 84 2e-16 ref|XP_009386788.1| PREDICTED: RING-H2 finger protein ATL16-like... 84 2e-16 ref|XP_003555510.1| PREDICTED: RING-H2 finger protein ATL16-like... 84 2e-16 ref|XP_021899554.1| RING-H2 finger protein ATL16-like [Carica pa... 84 2e-16 ref|XP_007144094.1| hypothetical protein PHAVU_007G128200g [Phas... 84 3e-16 ref|XP_014512737.1| RING-H2 finger protein ATL16 [Vigna radiata ... 84 3e-16 ref|XP_017435556.1| PREDICTED: RING-H2 finger protein ATL16 [Vig... 84 3e-16 ref|XP_004495316.1| PREDICTED: RING-H2 finger protein ATL16 [Cic... 84 3e-16 ref|XP_002529293.1| PREDICTED: RING-H2 finger protein ATL16 [Ric... 84 4e-16 ref|XP_021594250.1| RING-H2 finger protein ATL16-like [Manihot e... 84 5e-16 gb|KHN38986.1| RING-H2 finger protein ATL16 [Glycine soja] 83 7e-16 ref|XP_003535440.1| PREDICTED: RING-H2 finger protein ATL16-like... 83 7e-16 ref|XP_013665632.1| RING-H2 finger protein ATL1-like [Brassica n... 83 7e-16 >ref|XP_010262302.1| PREDICTED: RING-H2 finger protein ATL16-like [Nelumbo nucifera] Length = 351 Score = 88.2 bits (217), Expect = 8e-18 Identities = 38/60 (63%), Positives = 50/60 (83%) Frame = +2 Query: 269 LLSPMATHTHHPNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 L+ A +HP++PSS+T+FP+LAI+I+GIL TA LL+SYYVFVIKCC+ WHR D+LRR Sbjct: 17 LMENQANVVYHPSSPSSDTSFPILAIAILGILTTAFLLVSYYVFVIKCCLTWHRFDLLRR 76 >ref|XP_011029837.1| PREDICTED: RING-H2 finger protein ATL16-like [Populus euphratica] Length = 355 Score = 85.5 bits (210), Expect = 9e-17 Identities = 37/60 (61%), Positives = 49/60 (81%) Frame = +2 Query: 269 LLSPMATHTHHPNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 + +P + P T SSET+FP++AI+I+GILATA LL+SYY+FVIKCC+NWHR D+LRR Sbjct: 16 MTNPGGSSLFGPRTHSSETSFPIIAIAIIGILATAFLLVSYYIFVIKCCLNWHRIDLLRR 75 >ref|XP_021675607.1| RING-H2 finger protein ATL16 [Hevea brasiliensis] Length = 357 Score = 85.1 bits (209), Expect = 1e-16 Identities = 36/60 (60%), Positives = 50/60 (83%) Frame = +2 Query: 269 LLSPMATHTHHPNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 + SP + P++ SS+T+FP++AI+I+GILATA LL+SYY+FVIKCC+NWHR D+LRR Sbjct: 12 ITSPTGSSIFAPHSHSSDTSFPIIAIAIIGILATAFLLVSYYIFVIKCCLNWHRIDLLRR 71 >ref|XP_021606970.1| RING-H2 finger protein ATL16-like [Manihot esculenta] gb|OAY55584.1| hypothetical protein MANES_03G165400 [Manihot esculenta] Length = 354 Score = 84.7 bits (208), Expect = 2e-16 Identities = 36/60 (60%), Positives = 49/60 (81%) Frame = +2 Query: 269 LLSPMATHTHHPNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 + SP + P + SS+T+FP++AI+I+GILATA LL+SYY+FVIKCC+NWHR D+LRR Sbjct: 12 ITSPSGSSIFGPRSHSSDTSFPIIAIAIIGILATAFLLVSYYIFVIKCCLNWHRIDLLRR 71 >gb|PNT25063.1| hypothetical protein POPTR_008G165900v3 [Populus trichocarpa] Length = 355 Score = 84.7 bits (208), Expect = 2e-16 Identities = 37/60 (61%), Positives = 49/60 (81%) Frame = +2 Query: 269 LLSPMATHTHHPNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 + SP + P T SS+T+FP++AI+I+GILATA LL+SYY+FVIKCC+NWHR D+LRR Sbjct: 16 MTSPGDSSIFGPRTHSSDTSFPIIAIAIIGILATAFLLVSYYIFVIKCCLNWHRIDLLRR 75 >ref|XP_011030515.1| PREDICTED: RING-H2 finger protein ATL16-like [Populus euphratica] Length = 355 Score = 84.7 bits (208), Expect = 2e-16 Identities = 35/49 (71%), Positives = 46/49 (93%) Frame = +2 Query: 302 PNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 P T SS+T+FP++AI+I+GILATA+LL+SYY+FVIKCC+NWHR D+LRR Sbjct: 28 PRTQSSDTSFPIIAIAIIGILATALLLVSYYIFVIKCCLNWHRIDLLRR 76 >ref|XP_002314635.2| zinc finger family protein [Populus trichocarpa] gb|PNT15220.1| hypothetical protein POPTR_010G072700v3 [Populus trichocarpa] Length = 355 Score = 84.7 bits (208), Expect = 2e-16 Identities = 35/49 (71%), Positives = 46/49 (93%) Frame = +2 Query: 302 PNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 P T SS+T+FP++AI+I+GILATA+LL+SYY+FVIKCC+NWHR D+LRR Sbjct: 28 PRTQSSDTSFPIIAIAIIGILATALLLVSYYIFVIKCCLNWHRIDLLRR 76 >ref|XP_020222727.1| RING-H2 finger protein ATL16 [Cajanus cajan] Length = 353 Score = 84.3 bits (207), Expect = 2e-16 Identities = 35/50 (70%), Positives = 45/50 (90%) Frame = +2 Query: 299 HPNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 HP+ SS T+FP++AI+I+GI+ATA LL+SYY+FVIKCC+NWHR DVLRR Sbjct: 38 HPHLHSSSTSFPIIAIAIIGIMATAFLLVSYYIFVIKCCLNWHRIDVLRR 87 >ref|XP_009386788.1| PREDICTED: RING-H2 finger protein ATL16-like [Musa acuminata subsp. malaccensis] Length = 324 Score = 84.0 bits (206), Expect = 2e-16 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = +2 Query: 302 PNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 P +PSS T+FP+LAISIVGI+ T++LLLSYYVFVIKCC+NWHRSDV+ R Sbjct: 16 PPSPSSLTSFPILAISIVGIVTTSVLLLSYYVFVIKCCLNWHRSDVVSR 64 >ref|XP_003555510.1| PREDICTED: RING-H2 finger protein ATL16-like [Glycine max] gb|KHN01059.1| RING-H2 finger protein ATL1 [Glycine soja] gb|KRG92308.1| hypothetical protein GLYMA_20G203400 [Glycine max] Length = 364 Score = 84.3 bits (207), Expect = 2e-16 Identities = 35/50 (70%), Positives = 45/50 (90%) Frame = +2 Query: 299 HPNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 HP+ SS T+FP++AI+I+GI+ATA LL+SYY+FVIKCC+NWHR DVLRR Sbjct: 34 HPHQHSSSTSFPIIAIAIIGIMATAFLLVSYYIFVIKCCLNWHRIDVLRR 83 >ref|XP_021899554.1| RING-H2 finger protein ATL16-like [Carica papaya] Length = 329 Score = 84.0 bits (206), Expect = 2e-16 Identities = 36/57 (63%), Positives = 46/57 (80%) Frame = +2 Query: 278 PMATHTHHPNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 P T P SS+T+FP++AI+I+GILATA LL+SYY+FVIKCC+NWHR D+LRR Sbjct: 7 PPGTSIFGPRLHSSDTSFPIIAIAIIGILATAFLLVSYYIFVIKCCLNWHRIDILRR 63 >ref|XP_007144094.1| hypothetical protein PHAVU_007G128200g [Phaseolus vulgaris] gb|ESW16088.1| hypothetical protein PHAVU_007G128200g [Phaseolus vulgaris] Length = 353 Score = 84.0 bits (206), Expect = 3e-16 Identities = 34/50 (68%), Positives = 45/50 (90%) Frame = +2 Query: 299 HPNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 HP+ SS T+FP++AI+I+GI+ATA LL+SYY+FVIKCC+NWHR D+LRR Sbjct: 30 HPHQHSSSTSFPIIAIAIIGIMATAFLLVSYYIFVIKCCLNWHRIDILRR 79 >ref|XP_014512737.1| RING-H2 finger protein ATL16 [Vigna radiata var. radiata] Length = 358 Score = 84.0 bits (206), Expect = 3e-16 Identities = 34/50 (68%), Positives = 45/50 (90%) Frame = +2 Query: 299 HPNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 HP+ SS T+FP++AI+I+GI+ATA LL+SYY+FVIKCC+NWHR D+LRR Sbjct: 34 HPHQHSSSTSFPIIAIAIIGIMATAFLLVSYYIFVIKCCLNWHRIDILRR 83 >ref|XP_017435556.1| PREDICTED: RING-H2 finger protein ATL16 [Vigna angularis] gb|KOM52467.1| hypothetical protein LR48_Vigan09g112600 [Vigna angularis] dbj|BAT94722.1| hypothetical protein VIGAN_08134700 [Vigna angularis var. angularis] Length = 358 Score = 84.0 bits (206), Expect = 3e-16 Identities = 34/50 (68%), Positives = 45/50 (90%) Frame = +2 Query: 299 HPNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 HP+ SS T+FP++AI+I+GI+ATA LL+SYY+FVIKCC+NWHR D+LRR Sbjct: 34 HPHQHSSSTSFPIIAIAIIGIMATAFLLVSYYIFVIKCCLNWHRIDILRR 83 >ref|XP_004495316.1| PREDICTED: RING-H2 finger protein ATL16 [Cicer arietinum] Length = 365 Score = 84.0 bits (206), Expect = 3e-16 Identities = 42/83 (50%), Positives = 56/83 (67%) Frame = +2 Query: 200 SSSISYSNQFLLGWKLNFSTFCLLLSPMATHTHHPNTPSSETTFPVLAISIVGILATAIL 379 SS IS SN L + S ++ HP+ S T+FP++AI+I+GI+ATAIL Sbjct: 17 SSQISQSNTQALS---------PITSSSSSSIFHPHMHHSSTSFPIIAIAIIGIMATAIL 67 Query: 380 LLSYYVFVIKCCINWHRSDVLRR 448 L+SYY+FVIKCC+NWHR D+LRR Sbjct: 68 LVSYYIFVIKCCLNWHRIDLLRR 90 >ref|XP_002529293.1| PREDICTED: RING-H2 finger protein ATL16 [Ricinus communis] gb|EEF33062.1| ring finger protein, putative [Ricinus communis] Length = 376 Score = 84.0 bits (206), Expect = 4e-16 Identities = 34/51 (66%), Positives = 48/51 (94%) Frame = +2 Query: 296 HHPNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 ++P++ SS+T+FP++AI+I+GILATA LL+SYY+FVIKCC+NWHR D+LRR Sbjct: 27 NNPHSHSSDTSFPIIAIAIIGILATAFLLVSYYIFVIKCCLNWHRIDILRR 77 >ref|XP_021594250.1| RING-H2 finger protein ATL16-like [Manihot esculenta] gb|OAY28079.1| hypothetical protein MANES_15G039400 [Manihot esculenta] Length = 361 Score = 83.6 bits (205), Expect = 5e-16 Identities = 38/58 (65%), Positives = 48/58 (82%) Frame = +2 Query: 275 SPMATHTHHPNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 S TH+H SS+T+FP++AI+I+GILATA LL+SYY+FVIKCC+NWHR DVLRR Sbjct: 24 SIFGTHSH-----SSDTSFPIIAIAIIGILATAFLLVSYYIFVIKCCLNWHRVDVLRR 76 >gb|KHN38986.1| RING-H2 finger protein ATL16 [Glycine soja] Length = 367 Score = 83.2 bits (204), Expect = 7e-16 Identities = 34/50 (68%), Positives = 45/50 (90%) Frame = +2 Query: 299 HPNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 HP+ +S T+FP++AI+I+GI+ATA LL+SYY+FVIKCC+NWHR DVLRR Sbjct: 34 HPHQHASSTSFPIIAIAIIGIMATAFLLVSYYIFVIKCCLNWHRIDVLRR 83 >ref|XP_003535440.1| PREDICTED: RING-H2 finger protein ATL16-like [Glycine max] gb|KRH34486.1| hypothetical protein GLYMA_10G187100 [Glycine max] Length = 367 Score = 83.2 bits (204), Expect = 7e-16 Identities = 34/50 (68%), Positives = 45/50 (90%) Frame = +2 Query: 299 HPNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 HP+ +S T+FP++AI+I+GI+ATA LL+SYY+FVIKCC+NWHR DVLRR Sbjct: 34 HPHQHASSTSFPIIAIAIIGIMATAFLLVSYYIFVIKCCLNWHRIDVLRR 83 >ref|XP_013665632.1| RING-H2 finger protein ATL1-like [Brassica napus] Length = 371 Score = 83.2 bits (204), Expect = 7e-16 Identities = 36/59 (61%), Positives = 47/59 (79%), Gaps = 2/59 (3%) Frame = +2 Query: 278 PMATHTHH--PNTPSSETTFPVLAISIVGILATAILLLSYYVFVIKCCINWHRSDVLRR 448 P T T H P SS TTFP+LA++++GILATA+LL+SYY+FVIKCC+NWH+ D+ RR Sbjct: 23 PSTTFTSHIFPRGSSSGTTFPILAVAVIGILATALLLVSYYIFVIKCCLNWHQIDIFRR 81