BLASTX nr result
ID: Ophiopogon22_contig00000731
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon22_contig00000731 (444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261173.1| chaperone protein ClpC1, chloroplastic [Aspa... 69 1e-10 ref|XP_008778670.1| PREDICTED: ATP-dependent Clp protease ATP-bi... 58 2e-07 gb|PKA60868.1| ATP-dependent Clp protease ATP-binding subunit cl... 57 1e-06 ref|XP_010921845.1| PREDICTED: ATP-dependent Clp protease ATP-bi... 56 4e-06 >ref|XP_020261173.1| chaperone protein ClpC1, chloroplastic [Asparagus officinalis] gb|ONK72082.1| uncharacterized protein A4U43_C04F15500 [Asparagus officinalis] Length = 919 Score = 68.6 bits (166), Expect = 1e-10 Identities = 39/63 (61%), Positives = 43/63 (68%) Frame = +2 Query: 254 MAGALVQLATLPAVXXXXXXXXXXXXXXXXATKMMGSARSHPLRLQGFTGLRGLNTLDFP 433 MAGALVQ AT+PAV A+KMMGSA+S PLRLQGFTGLRGLN LDF Sbjct: 1 MAGALVQSATIPAVVVGNCSQIPGKTRR--ASKMMGSAQSRPLRLQGFTGLRGLNALDFS 58 Query: 434 SRS 442 S+S Sbjct: 59 SKS 61 >ref|XP_008778670.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4B, chloroplastic-like [Phoenix dactylifera] Length = 195 Score = 57.8 bits (138), Expect = 2e-07 Identities = 35/64 (54%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Frame = +2 Query: 254 MAGALVQLATLPA-VXXXXXXXXXXXXXXXXATKMMGSARSHPLRLQGFTGLRGLNTLDF 430 MAGALVQ A LP+ V A KMMG+ RSHPLRLQ F GLRG N LD Sbjct: 1 MAGALVQSAILPSQVVSRNRGQLKGAGKTRKAPKMMGNLRSHPLRLQDFAGLRGANNLDL 60 Query: 431 PSRS 442 SRS Sbjct: 61 LSRS 64 >gb|PKA60868.1| ATP-dependent Clp protease ATP-binding subunit clpA like CD4A, chloroplastic [Apostasia shenzhenica] Length = 921 Score = 57.0 bits (136), Expect = 1e-06 Identities = 30/63 (47%), Positives = 33/63 (52%) Frame = +2 Query: 254 MAGALVQLATLPAVXXXXXXXXXXXXXXXXATKMMGSARSHPLRLQGFTGLRGLNTLDFP 433 MAG L+Q +P V M+ RSHPLRLQGF GLR NTLDFP Sbjct: 1 MAGTLIQSLAIPVVASNRSYNQVRCCRKTKGVTMLCHVRSHPLRLQGFKGLRSSNTLDFP 60 Query: 434 SRS 442 SRS Sbjct: 61 SRS 63 >ref|XP_010921845.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4A, chloroplastic-like [Elaeis guineensis] Length = 914 Score = 55.8 bits (133), Expect = 4e-06 Identities = 31/63 (49%), Positives = 35/63 (55%) Frame = +2 Query: 254 MAGALVQLATLPAVXXXXXXXXXXXXXXXXATKMMGSARSHPLRLQGFTGLRGLNTLDFP 433 MAG LV+LAT PAV MM + R PLR+QGFTGLR LN LDFP Sbjct: 1 MAGTLVKLATFPAVTSRGHIQIQGSRKPSRLALMMCNVRVSPLRMQGFTGLRQLNALDFP 60 Query: 434 SRS 442 +S Sbjct: 61 YKS 63