BLASTX nr result
ID: Ophiopogon21_contig00046541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00046541 (367 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004338809.1| CBS domain containing protein [Acanthamoeba ... 58 3e-06 >ref|XP_004338809.1| CBS domain containing protein [Acanthamoeba castellanii str. Neff] gi|440795679|gb|ELR16796.1| CBS domain containing protein [Acanthamoeba castellanii str. Neff] Length = 348 Score = 57.8 bits (138), Expect = 3e-06 Identities = 38/103 (36%), Positives = 58/103 (56%) Frame = -1 Query: 367 DKQGVLVDVISIRDLRGIGSTADNFRILFLSVTKFKDECRKAFPPKYTSSKAIYVTQNDK 188 +++G +VD IS RDLRGI A L+ SV FK + + + +YV +D Sbjct: 248 NEEGAVVDNISTRDLRGIKYDAKMLWRLWESVAFFKRRIVEG--DQKAPTDVVYVLNSDT 305 Query: 187 FEKVIRTMKDENIHRVFVCEMDEHGLPKPVHVVTQRDALRFLL 59 E V++ M D +IHRVFV + + H +PV V++Q D L+ +L Sbjct: 306 LETVVQKMADHHIHRVFVVDDELH--KRPVRVLSQCDILQNVL 346