BLASTX nr result
ID: Ophiopogon21_contig00046263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00046263 (402 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIV82530.1| hypothetical protein PV11_04632 [Exophiala sideris] 56 9e-06 >gb|KIV82530.1| hypothetical protein PV11_04632 [Exophiala sideris] Length = 279 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/50 (54%), Positives = 30/50 (60%) Frame = -3 Query: 400 SWKGSADSALANGTSDASAKDISMHDSSDQKPSESDTAAGSNLGDPPDRM 251 SWKG+ L NG + KDIS SSD KP+ESD A SN GD PD M Sbjct: 206 SWKGNERPVLLNGEDSSETKDISQQSSSDIKPNESDAAMDSNAGDQPDPM 255