BLASTX nr result
ID: Ophiopogon21_contig00046175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00046175 (372 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESA10146.1| hypothetical protein GLOINDRAFT_348325 [Rhizophag... 103 5e-20 >gb|ESA10146.1| hypothetical protein GLOINDRAFT_348325 [Rhizophagus irregularis DAOM 181602] gi|595478511|gb|EXX67899.1| hypothetical protein RirG_110080 [Rhizophagus irregularis DAOM 197198w] gi|595487229|gb|EXX73038.1| hypothetical protein RirG_063780 [Rhizophagus irregularis DAOM 197198w] Length = 333 Score = 103 bits (257), Expect = 5e-20 Identities = 58/107 (54%), Positives = 75/107 (70%), Gaps = 3/107 (2%) Frame = -3 Query: 313 PMKMVKPNKTRVD--VPLTPPEDKQ-RSVSFDLLLNVLHPYEKHCTDLNGYNGFANSPAE 143 P+ M KPNKTRVD P TPP D++ RSVSFD + L + D + NGF NSP+E Sbjct: 24 PLNMSKPNKTRVDNISPPTPPSDEEKRSVSFDPSVKTLSIPK----DFSYSNGFINSPSE 79 Query: 142 SIDIAVRDLSQDICVSLYQRHVEMKEIFSRNQEFFDTVRQATFEDDE 2 SIDI+VRD S+++ VSL +R E+K++ NQEFFDTV+Q+ FEDDE Sbjct: 80 SIDISVRDCSEEMLVSLKERDTEIKDLVVHNQEFFDTVKQSIFEDDE 126