BLASTX nr result
ID: Ophiopogon21_contig00045459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00045459 (627 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_009906814.1| hypothetical protein [Burkholderia thailande... 59 2e-06 ref|WP_009892562.1| hypothetical protein [Burkholderia thailande... 58 4e-06 ref|WP_010102122.1| hypothetical protein [Burkholderia oklahomen... 58 4e-06 ref|WP_048984580.1| MULTISPECIES: hypothetical protein [Burkhold... 58 5e-06 ref|WP_038745246.1| hypothetical protein [Burkholderia pseudomal... 58 5e-06 ref|WP_006488939.1| MULTISPECIES: hypothetical protein [Burkhold... 58 5e-06 ref|WP_006496136.1| MULTISPECIES: hypothetical protein [Burkhold... 58 5e-06 ref|WP_042586112.1| MULTISPECIES: hypothetical protein [Burkhold... 57 8e-06 ref|WP_027812503.1| hypothetical protein [Burkholderia cenocepacia] 57 8e-06 ref|WP_014723486.1| MULTISPECIES: hypothetical protein [Burkhold... 57 8e-06 ref|WP_010090952.1| hypothetical protein [Burkholderia ubonensis] 57 8e-06 >ref|WP_009906814.1| hypothetical protein [Burkholderia thailandensis] gi|584093388|gb|AHI64968.1| hypothetical protein BTL_2912 [Burkholderia thailandensis H0587] gi|685783497|gb|AIP64656.1| hypothetical protein DR62_1986 [Burkholderia thailandensis] gi|773048025|gb|AJY27980.1| hypothetical protein BTM_972 [Burkholderia thailandensis 34] Length = 222 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/70 (40%), Positives = 40/70 (57%) Frame = -3 Query: 424 EVAIFGQVYDDHSGIHQVHMNSYAAGHHSVSHSHESPQDSHHGPKQDGALLVKLGPNHWK 245 ++ +FG+ Y + +GIH HMN ++G H H + H+ QDGALLV LG W Sbjct: 137 DLYVFGRTYVEGNGIHDTHMNQGSSGPH-FQHRPSDDANDHNDVWQDGALLVDLGGEQWA 195 Query: 244 AVFVAFDTQI 215 A F AF+ Q+ Sbjct: 196 AYFAAFEQQV 205 >ref|WP_009892562.1| hypothetical protein [Burkholderia thailandensis] gi|83653879|gb|ABC37942.1| conserved hypothetical protein [Burkholderia thailandensis E264] gi|584100132|gb|AHI71768.1| hypothetical protein BTQ_809 [Burkholderia thailandensis 2002721723] gi|584106861|gb|AHI78479.1| hypothetical protein BTJ_1632 [Burkholderia thailandensis E444] gi|655538446|gb|AIC87622.1| hypothetical protein BTRA_3226 [Burkholderia thailandensis USAMRU Malaysia #20] gi|685744433|gb|AIP25605.1| hypothetical protein DR63_2567 [Burkholderia thailandensis E264] gi|695180195|gb|AIS95978.1| hypothetical protein BTHA_3131 [Burkholderia thailandensis MSMB59] gi|695925070|gb|AIT22273.1| hypothetical protein BTN_1797 [Burkholderia thailandensis E254] gi|757940675|gb|KIS56406.1| hypothetical protein BTP_1953 [Burkholderia thailandensis Phuket 4W-1] gi|772991592|gb|AJX99956.1| hypothetical protein BG87_3106 [Burkholderia thailandensis 2002721643] Length = 222 Score = 58.2 bits (139), Expect = 4e-06 Identities = 28/69 (40%), Positives = 39/69 (56%) Frame = -3 Query: 424 EVAIFGQVYDDHSGIHQVHMNSYAAGHHSVSHSHESPQDSHHGPKQDGALLVKLGPNHWK 245 ++ +FG+ Y + +GIH HMN ++G H H + H+ QDGALLV LG W Sbjct: 137 DLYVFGRTYVEGNGIHDTHMNQGSSGPH-FQHRPSDDANDHNDVWQDGALLVDLGGEQWA 195 Query: 244 AVFVAFDTQ 218 A F AF+ Q Sbjct: 196 AYFAAFEQQ 204 >ref|WP_010102122.1| hypothetical protein [Burkholderia oklahomensis] gi|685679334|gb|AIO66454.1| hypothetical protein DM82_317 [Burkholderia oklahomensis] gi|772970914|gb|AJX30972.1| hypothetical protein BG90_707 [Burkholderia oklahomensis C6786] Length = 222 Score = 58.2 bits (139), Expect = 4e-06 Identities = 28/69 (40%), Positives = 40/69 (57%) Frame = -3 Query: 424 EVAIFGQVYDDHSGIHQVHMNSYAAGHHSVSHSHESPQDSHHGPKQDGALLVKLGPNHWK 245 ++ +FG+ Y + +GIH HMN + G H + + + D H+ QDGALLV LG W Sbjct: 137 DLYVFGRTYVEGNGIHDTHMNQGSTGPHFLHQAGDDAND-HNDVWQDGALLVDLGGEQWA 195 Query: 244 AVFVAFDTQ 218 A F AF+ Q Sbjct: 196 AYFAAFEQQ 204 >ref|WP_048984580.1| MULTISPECIES: hypothetical protein [Burkholderia cepacia complex] Length = 223 Score = 57.8 bits (138), Expect = 5e-06 Identities = 27/69 (39%), Positives = 40/69 (57%) Frame = -3 Query: 424 EVAIFGQVYDDHSGIHQVHMNSYAAGHHSVSHSHESPQDSHHGPKQDGALLVKLGPNHWK 245 +V +FG+ Y +GIH HMN + G H + + + D H+ QDGALLV++ + W Sbjct: 137 DVVVFGRTYAQGNGIHDTHMNQGSTGPHYLHRAGDDHND-HNDVWQDGALLVRVSESQWA 195 Query: 244 AVFVAFDTQ 218 A F AF+ Q Sbjct: 196 AYFAAFEQQ 204 >ref|WP_038745246.1| hypothetical protein [Burkholderia pseudomallei] gi|705474925|gb|KGS04792.1| hypothetical protein X946_2611 [Burkholderia pseudomallei ABCPW 111] Length = 222 Score = 57.8 bits (138), Expect = 5e-06 Identities = 29/69 (42%), Positives = 40/69 (57%) Frame = -3 Query: 424 EVAIFGQVYDDHSGIHQVHMNSYAAGHHSVSHSHESPQDSHHGPKQDGALLVKLGPNHWK 245 ++ +FG+ Y + +GIH HMN +AG H + + D H+ QDGALLV LG W Sbjct: 137 DLYVFGRTYVEGNGIHDTHMNQGSAGPHFLHQLGDDAND-HNDVWQDGALLVDLGGAQWA 195 Query: 244 AVFVAFDTQ 218 A F AF+ Q Sbjct: 196 AYFAAFEQQ 204 >ref|WP_006488939.1| MULTISPECIES: hypothetical protein [Burkholderia cepacia complex] gi|198037083|emb|CAR53004.1| conserved hypothetical protein [Burkholderia cenocepacia J2315] gi|529209644|gb|EPZ86377.1| PF10042 family protein [Burkholderia cenocepacia K56-2Valvano] gi|542091392|gb|ERI30489.1| PF10042 family protein [Burkholderia cenocepacia BC7] gi|757908403|gb|KIS47203.1| hypothetical protein NP88_4454 [Burkholderia cepacia] gi|815847425|gb|KKI78266.1| hypothetical protein WQ49_26715 [Burkholderia cenocepacia] Length = 223 Score = 57.8 bits (138), Expect = 5e-06 Identities = 27/69 (39%), Positives = 40/69 (57%) Frame = -3 Query: 424 EVAIFGQVYDDHSGIHQVHMNSYAAGHHSVSHSHESPQDSHHGPKQDGALLVKLGPNHWK 245 +V +FG+ Y +GIH HMN + G H + + + D H+ QDGALLV++ + W Sbjct: 137 DVVVFGRTYAQGNGIHDTHMNQGSTGPHYLHRAGDDHND-HNDVWQDGALLVRVSESQWA 195 Query: 244 AVFVAFDTQ 218 A F AF+ Q Sbjct: 196 AYFAAFEQQ 204 >ref|WP_006496136.1| MULTISPECIES: hypothetical protein [Burkholderia cepacia complex] gi|590117030|emb|CDN61087.1| Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1) [Burkholderia cenocepacia H111] gi|685661837|gb|AIO48964.1| hypothetical protein DM42_2574 [Burkholderia cepacia] gi|686815862|gb|KGB95346.1| hypothetical protein DM44_2372 [Burkholderia cepacia] Length = 223 Score = 57.8 bits (138), Expect = 5e-06 Identities = 27/69 (39%), Positives = 40/69 (57%) Frame = -3 Query: 424 EVAIFGQVYDDHSGIHQVHMNSYAAGHHSVSHSHESPQDSHHGPKQDGALLVKLGPNHWK 245 +V +FG+ Y +GIH HMN + G H + + + D H+ QDGALLV++ + W Sbjct: 137 DVVVFGRTYAQGNGIHDTHMNQGSTGPHYLHRAGDDHND-HNDVWQDGALLVRVSESQWA 195 Query: 244 AVFVAFDTQ 218 A F AF+ Q Sbjct: 196 AYFAAFEQQ 204 >ref|WP_042586112.1| MULTISPECIES: hypothetical protein [Burkholderia] gi|755171211|gb|KIP16054.1| hypothetical protein KY49_4697 [Burkholderia sp. MSHR3999] gi|772925900|gb|AJX16571.1| hypothetical protein BW23_2393 [Burkholderia ubonensis MSMB22] Length = 223 Score = 57.0 bits (136), Expect = 8e-06 Identities = 26/69 (37%), Positives = 41/69 (59%) Frame = -3 Query: 424 EVAIFGQVYDDHSGIHQVHMNSYAAGHHSVSHSHESPQDSHHGPKQDGALLVKLGPNHWK 245 +V +FG+ Y + +GIH HMN ++G H + + + D H+ QDGAL+V++ W Sbjct: 137 DVVVFGRTYVEGNGIHDTHMNQGSSGPHFLHRAGDDHND-HNDIWQDGALIVRVSDTQWA 195 Query: 244 AVFVAFDTQ 218 A F AF+ Q Sbjct: 196 AYFAAFEQQ 204 >ref|WP_027812503.1| hypothetical protein [Burkholderia cenocepacia] Length = 223 Score = 57.0 bits (136), Expect = 8e-06 Identities = 27/71 (38%), Positives = 40/71 (56%) Frame = -3 Query: 430 DHEVAIFGQVYDDHSGIHQVHMNSYAAGHHSVSHSHESPQDSHHGPKQDGALLVKLGPNH 251 D +V +FG+ Y +GIH HMN + G + + H + + H+ QDGALLV++ Sbjct: 135 DLDVVVFGRTYAQGNGIHDTHMNQGSTGPNYL-HRADDDHNDHNDVWQDGALLVRVSDTQ 193 Query: 250 WKAVFVAFDTQ 218 W A F AF+ Q Sbjct: 194 WAAYFAAFEQQ 204 >ref|WP_014723486.1| MULTISPECIES: hypothetical protein [Burkholderia] gi|387577902|gb|AFJ86618.1| Branched-chain amino acid transport ATP-binding protein LivF [Burkholderia sp. KJ006] Length = 223 Score = 57.0 bits (136), Expect = 8e-06 Identities = 26/72 (36%), Positives = 41/72 (56%) Frame = -3 Query: 433 HDHEVAIFGQVYDDHSGIHQVHMNSYAAGHHSVSHSHESPQDSHHGPKQDGALLVKLGPN 254 H +V +FG+ Y + +GIH HMN + G + + + + D H+ QDGAL V++ + Sbjct: 134 HGLDVVVFGRTYSEGNGIHDTHMNQGSTGSNYLHRAGDDHND-HNDVWQDGALFVRVSES 192 Query: 253 HWKAVFVAFDTQ 218 W A F AF+ Q Sbjct: 193 QWAAYFAAFEQQ 204 >ref|WP_010090952.1| hypothetical protein [Burkholderia ubonensis] Length = 223 Score = 57.0 bits (136), Expect = 8e-06 Identities = 26/69 (37%), Positives = 41/69 (59%) Frame = -3 Query: 424 EVAIFGQVYDDHSGIHQVHMNSYAAGHHSVSHSHESPQDSHHGPKQDGALLVKLGPNHWK 245 +V +FG+ Y + +GIH HMN ++G H + + + D H+ QDGAL+V++ W Sbjct: 137 DVVVFGRTYVEGNGIHDTHMNQGSSGPHFMHRAGDDHND-HNDIWQDGALIVRVSDTQWA 195 Query: 244 AVFVAFDTQ 218 A F AF+ Q Sbjct: 196 AYFAAFEQQ 204