BLASTX nr result
ID: Ophiopogon21_contig00045261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00045261 (354 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIW45646.1| hypothetical protein PV06_04019 [Exophiala oligos... 87 4e-15 gb|KIW73886.1| hypothetical protein PV04_01967 [Capronia semiimm... 87 5e-15 gb|KIV88163.1| hypothetical protein PV10_09084 [Exophiala mesoph... 86 8e-15 gb|KKK16663.1| telomere and ribosome associated protein [Aspergi... 83 9e-14 gb|KIW16171.1| hypothetical protein PV08_06222 [Exophiala spinif... 83 9e-14 gb|KPI37296.1| hypothetical protein AB675_1487 [Phialophora attae] 81 3e-13 ref|XP_013269181.1| hypothetical protein Z518_07984 [Rhinocladie... 81 3e-13 gb|EGD94952.1| telomere and ribosome associated protein Stm1 [Tr... 81 3e-13 ref|XP_002144001.1| telomere and ribosome associated protein Stm... 80 5e-13 ref|XP_003068507.1| hypothetical protein CPC735_005340 [Coccidio... 80 5e-13 gb|KIY00233.1| hypothetical protein Z520_03918 [Fonsecaea multim... 80 6e-13 emb|CRG85915.1| plasminogen activator inhibitor 1 RNA-binding pr... 80 8e-13 gb|EZF11045.1| hypothetical protein H100_07789, partial [Trichop... 79 1e-12 ref|XP_007719217.1| hypothetical protein A1O1_00106 [Capronia co... 79 1e-12 ref|XP_003238370.1| hypothetical protein TERG_00360 [Trichophyto... 79 1e-12 gb|KMU85213.1| hypothetical protein CIHG_02996 [Coccidioides imm... 79 1e-12 gb|KIV80301.1| hypothetical protein PV11_07814 [Exophiala sideris] 79 1e-12 ref|XP_009158102.1| hypothetical protein HMPREF1120_05670 [Exoph... 79 1e-12 ref|XP_001244338.1| telomere and ribosome associated protein Stm... 79 1e-12 gb|KIW25029.1| hypothetical protein PV07_10702 [Cladophialophora... 79 2e-12 >gb|KIW45646.1| hypothetical protein PV06_04019 [Exophiala oligosperma] Length = 351 Score = 87.4 bits (215), Expect = 4e-15 Identities = 43/62 (69%), Positives = 45/62 (72%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPKPERTDGAPRRGTDE 11 M DVKSKNLYELLGN DQDSDREPEPP K V+KT R GKRDAPK TD + RG Sbjct: 1 MADVKSKNLYELLGNTSDQDSDREPEPPTKAVDKTAARVGKRDAPKAAPTDASSARGRGG 60 Query: 10 RR 5 RR Sbjct: 61 RR 62 >gb|KIW73886.1| hypothetical protein PV04_01967 [Capronia semiimmersa] Length = 379 Score = 87.0 bits (214), Expect = 5e-15 Identities = 43/61 (70%), Positives = 44/61 (72%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPKPERTDGAPRRGTDE 11 M DVKSKNLYELLGN DQDSDREPEPP KTV+KT PR GKRDAPK A R G Sbjct: 1 MADVKSKNLYELLGNTSDQDSDREPEPPTKTVDKTAPRHGKRDAPKEAPAPPADRAGVAP 60 Query: 10 R 8 R Sbjct: 61 R 61 >gb|KIV88163.1| hypothetical protein PV10_09084 [Exophiala mesophila] Length = 356 Score = 86.3 bits (212), Expect = 8e-15 Identities = 44/64 (68%), Positives = 46/64 (71%), Gaps = 2/64 (3%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPK--PERTDGAPRRGT 17 MTDVKSKNLYELLGN DQDSDREPEPP K ++KT PRSGKRDAPK P RG Sbjct: 1 MTDVKSKNLYELLGNTSDQDSDREPEPPTKAIDKTAPRSGKRDAPKAAPAAPTEVAGRGR 60 Query: 16 DERR 5 RR Sbjct: 61 GGRR 64 >gb|KKK16663.1| telomere and ribosome associated protein [Aspergillus ochraceoroseus] gi|816352796|gb|KKK26871.1| telomere and ribosome associated protein [Aspergillus rambellii] Length = 293 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 3/60 (5%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPK--PERT-DGAPRRG 20 M DV+SKNLYELLGNDP+ D +REPEPP K ++K +PR GKRDAPK P RT + APRRG Sbjct: 1 MADVRSKNLYELLGNDPEFDPNREPEPPTKALDKPVPRHGKRDAPKEAPVRTAESAPRRG 60 >gb|KIW16171.1| hypothetical protein PV08_06222 [Exophiala spinifera] Length = 351 Score = 82.8 bits (203), Expect = 9e-14 Identities = 41/62 (66%), Positives = 43/62 (69%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPKPERTDGAPRRGTDE 11 M DVKSKNLYELLGN DQDSDREPEPP K V+K R GKRDAPK T+ RG Sbjct: 1 MADVKSKNLYELLGNTSDQDSDREPEPPTKAVDKPAARVGKRDAPKAAPTEAPSARGRGG 60 Query: 10 RR 5 RR Sbjct: 61 RR 62 >gb|KPI37296.1| hypothetical protein AB675_1487 [Phialophora attae] Length = 344 Score = 80.9 bits (198), Expect = 3e-13 Identities = 42/66 (63%), Positives = 45/66 (68%), Gaps = 5/66 (7%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPK-----PERTDGAPR 26 MTDVKSKNLYELLGN DQDSDREPEPP K ++K RSGKRDAPK P + G R Sbjct: 1 MTDVKSKNLYELLGNTSDQDSDREPEPPTKAIDKPTARSGKRDAPKEAPAAPAASVGGAR 60 Query: 25 RGTDER 8 G R Sbjct: 61 GGRGGR 66 >ref|XP_013269181.1| hypothetical protein Z518_07984 [Rhinocladiella mackenziei CBS 650.93] gi|759325715|gb|KIX02045.1| hypothetical protein Z518_07984 [Rhinocladiella mackenziei CBS 650.93] Length = 839 Score = 80.9 bits (198), Expect = 3e-13 Identities = 44/77 (57%), Positives = 49/77 (63%), Gaps = 8/77 (10%) Frame = -3 Query: 211 EGALFG------VMTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPK- 53 +G+L G VM DVKSKNLYELLGN DQDSDREP+PP K V+K R GKRDAPK Sbjct: 470 QGSLHGRRSRGNVMADVKSKNLYELLGNTSDQDSDREPDPPTKAVDKPAARHGKRDAPKT 529 Query: 52 -PERTDGAPRRGTDERR 5 P + RG RR Sbjct: 530 APTEPESVATRGRGGRR 546 >gb|EGD94952.1| telomere and ribosome associated protein Stm1 [Trichophyton tonsurans CBS 112818] gi|326478506|gb|EGE02516.1| telomere and ribosome associated protein Stm1 [Trichophyton equinum CBS 127.97] gi|607892965|gb|EZF32212.1| hypothetical protein H101_04200 [Trichophyton interdigitale H6] Length = 315 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/57 (64%), Positives = 43/57 (75%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPKPERTDGAPRRG 20 M DV+SKN+YELLGNDP+ D +REPEPPV+ V+KT PR GKRD P R AP RG Sbjct: 1 MADVRSKNMYELLGNDPELDPNREPEPPVQVVDKTAPRRGKRDGPNEPRDAVAPPRG 57 >ref|XP_002144001.1| telomere and ribosome associated protein Stm1, putative [Talaromyces marneffei ATCC 18224] gi|210073399|gb|EEA27486.1| telomere and ribosome associated protein Stm1, putative [Talaromyces marneffei ATCC 18224] gi|679998497|gb|KFX50707.1| Suppressor protein STM1 [Talaromyces marneffei PM1] Length = 309 Score = 80.5 bits (197), Expect = 5e-13 Identities = 39/59 (66%), Positives = 43/59 (72%), Gaps = 2/59 (3%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPK--PERTDGAPRRG 20 M DV+SKNLYELLGNDP+ DSDREPEPP K ++K R GKRDAPK P APR G Sbjct: 1 MADVRSKNLYELLGNDPELDSDREPEPPTKAIDKPAQRHGKRDAPKEAPAAPPAAPRGG 59 >ref|XP_003068507.1| hypothetical protein CPC735_005340 [Coccidioides posadasii C735 delta SOWgp] gi|240108188|gb|EER26362.1| hypothetical protein CPC735_005340 [Coccidioides posadasii C735 delta SOWgp] gi|320038393|gb|EFW20329.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] gi|855539021|gb|KMM73109.1| hypothetical protein CPAG_09398 [Coccidioides posadasii RMSCC 3488] Length = 304 Score = 80.5 bits (197), Expect = 5e-13 Identities = 39/67 (58%), Positives = 47/67 (70%), Gaps = 6/67 (8%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAP------KPERTDGAP 29 M+DV+SKN+YELLGNDP+ D DREP+PPVK V+KT PR GKRD P P + G P Sbjct: 1 MSDVRSKNIYELLGNDPELDPDREPQPPVKVVDKTAPRHGKRDGPVQPRGSNPALSRGGP 60 Query: 28 RRGTDER 8 R +ER Sbjct: 61 RYTGNER 67 >gb|KIY00233.1| hypothetical protein Z520_03918 [Fonsecaea multimorphosa CBS 102226] Length = 378 Score = 80.1 bits (196), Expect = 6e-13 Identities = 40/61 (65%), Positives = 45/61 (73%), Gaps = 6/61 (9%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPK------PERTDGAP 29 M DVKSKNLYELLGN DQDSDREP+PP K ++K + RSGKRDAPK ER + AP Sbjct: 1 MADVKSKNLYELLGNTSDQDSDREPDPPTKAIDKPVARSGKRDAPKEAPAAPTERANVAP 60 Query: 28 R 26 R Sbjct: 61 R 61 >emb|CRG85915.1| plasminogen activator inhibitor 1 RNA-binding protein [Talaromyces islandicus] Length = 309 Score = 79.7 bits (195), Expect = 8e-13 Identities = 39/59 (66%), Positives = 43/59 (72%), Gaps = 2/59 (3%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPK--PERTDGAPRRG 20 M DV+SKNLYELLGNDP+ DSDREPEPP K V++ R GKRDAPK P APR G Sbjct: 1 MADVRSKNLYELLGNDPELDSDREPEPPTKAVDRPAARHGKRDAPKEAPSAPAAAPRGG 59 >gb|EZF11045.1| hypothetical protein H100_07789, partial [Trichophyton rubrum MR850] gi|607900196|gb|EZF37919.1| hypothetical protein H102_07753, partial [Trichophyton rubrum CBS 100081] gi|607912319|gb|EZF48555.1| hypothetical protein H103_07778, partial [Trichophyton rubrum CBS 288.86] gi|607924401|gb|EZF59196.1| hypothetical protein H104_07726, partial [Trichophyton rubrum CBS 289.86] gi|607936292|gb|EZF69784.1| hypothetical protein H105_07779, partial [Trichophyton soudanense CBS 452.61] gi|607948441|gb|EZF80584.1| hypothetical protein H110_07775, partial [Trichophyton rubrum MR1448] gi|607960437|gb|EZF91115.1| hypothetical protein H113_07832, partial [Trichophyton rubrum MR1459] gi|607984463|gb|EZG12724.1| hypothetical protein H107_07915, partial [Trichophyton rubrum CBS 202.88] gi|633054532|gb|KDB29761.1| hypothetical protein H112_07765, partial [Trichophyton rubrum D6] gi|674804815|gb|KFL60209.1| hypothetical protein TERG_11550, partial [Trichophyton rubrum CBS 118892] Length = 137 Score = 79.3 bits (194), Expect = 1e-12 Identities = 36/57 (63%), Positives = 42/57 (73%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPKPERTDGAPRRG 20 M DV+SKN+YELLGNDP+ D +REPEPPV+ V+K PR GKRD P R AP RG Sbjct: 1 MADVRSKNIYELLGNDPELDPNREPEPPVQVVDKNAPRRGKRDGPSEPRDTVAPPRG 57 >ref|XP_007719217.1| hypothetical protein A1O1_00106 [Capronia coronata CBS 617.96] gi|590019791|gb|EXJ94988.1| hypothetical protein A1O1_00106 [Capronia coronata CBS 617.96] Length = 379 Score = 79.3 bits (194), Expect = 1e-12 Identities = 42/64 (65%), Positives = 43/64 (67%), Gaps = 2/64 (3%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPK--PERTDGAPRRGT 17 M DVKSKNLYELLGN DQDSDREPEPP K VEK LPR GKR+A K P RG Sbjct: 1 MADVKSKNLYELLGNTSDQDSDREPEPPTKAVEKPLPRHGKREAVKDAPVEAGSVAVRGR 60 Query: 16 DERR 5 RR Sbjct: 61 GGRR 64 >ref|XP_003238370.1| hypothetical protein TERG_00360 [Trichophyton rubrum CBS 118892] gi|607972706|gb|EZG02017.1| hypothetical protein H106_07612 [Trichophyton rubrum CBS 735.88] gi|861296624|gb|KMQ41186.1| hypothetical protein HL42_8108 [Trichophyton rubrum] Length = 315 Score = 79.3 bits (194), Expect = 1e-12 Identities = 36/57 (63%), Positives = 42/57 (73%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPKPERTDGAPRRG 20 M DV+SKN+YELLGNDP+ D +REPEPPV+ V+K PR GKRD P R AP RG Sbjct: 1 MADVRSKNIYELLGNDPELDPNREPEPPVQVVDKNAPRRGKRDGPSEPRDTVAPPRG 57 >gb|KMU85213.1| hypothetical protein CIHG_02996 [Coccidioides immitis H538.4] Length = 304 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/67 (56%), Positives = 47/67 (70%), Gaps = 6/67 (8%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAP------KPERTDGAP 29 M+DV+SKN+YELLGNDP+ D DREP+PPVK V+KT PR GKR+ P P + G P Sbjct: 1 MSDVRSKNIYELLGNDPELDPDREPQPPVKVVDKTAPRHGKREGPVQPRGSNPALSRGGP 60 Query: 28 RRGTDER 8 R +ER Sbjct: 61 RYTGNER 67 >gb|KIV80301.1| hypothetical protein PV11_07814 [Exophiala sideris] Length = 387 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPK 53 M DVKSKNLYELLGN DQDSDREPEPP K ++K + RSGKRDAPK Sbjct: 1 MADVKSKNLYELLGNTSDQDSDREPEPPTKAIDKPVARSGKRDAPK 46 >ref|XP_009158102.1| hypothetical protein HMPREF1120_05670 [Exophiala dermatitidis NIH/UT8656] gi|378731182|gb|EHY57641.1| hypothetical protein HMPREF1120_05670 [Exophiala dermatitidis NIH/UT8656] Length = 350 Score = 79.0 bits (193), Expect = 1e-12 Identities = 41/64 (64%), Positives = 45/64 (70%), Gaps = 3/64 (4%) Frame = -3 Query: 187 TDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPKPERTDGAPR---RGT 17 TDVKSKNLYELLGN DQDSDREPEPP K VEK +PR GKR+AP+ + A RG Sbjct: 3 TDVKSKNLYELLGNTSDQDSDREPEPPTKAVEKPVPRHGKRNAPEVTPVEAAGNVAVRGR 62 Query: 16 DERR 5 RR Sbjct: 63 GGRR 66 >ref|XP_001244338.1| telomere and ribosome associated protein Stm1 [Coccidioides immitis RS] gi|90303124|gb|EAS32755.1| telomere and ribosome associated protein Stm1 [Coccidioides immitis RS] gi|859414426|gb|KMP08018.1| hypothetical protein CIRG_07699 [Coccidioides immitis RMSCC 2394] gi|875285975|gb|KMU79696.1| hypothetical protein CISG_02114 [Coccidioides immitis RMSCC 3703] Length = 304 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/67 (56%), Positives = 47/67 (70%), Gaps = 6/67 (8%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAP------KPERTDGAP 29 M+DV+SKN+YELLGNDP+ D DREP+PPVK V+KT PR GKR+ P P + G P Sbjct: 1 MSDVRSKNIYELLGNDPELDPDREPQPPVKVVDKTAPRHGKREGPVQPRGSNPALSRGGP 60 Query: 28 RRGTDER 8 R +ER Sbjct: 61 RYTGNER 67 >gb|KIW25029.1| hypothetical protein PV07_10702 [Cladophialophora immunda] Length = 366 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/60 (65%), Positives = 44/60 (73%), Gaps = 5/60 (8%) Frame = -3 Query: 190 MTDVKSKNLYELLGNDPDQDSDREPEPPVKTVEKTLPRSGKRDAPK-----PERTDGAPR 26 M DVKSKNLYELLGN DQDSDREP+PP K ++K + R GKRDAPK ER + APR Sbjct: 1 MADVKSKNLYELLGNTSDQDSDREPDPPTKAIDKPVARHGKRDAPKEAPATTERANVAPR 60