BLASTX nr result
ID: Ophiopogon21_contig00045247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00045247 (372 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013325514.1| hypothetical protein T310_7142 [Rasamsonia e... 69 1e-09 dbj|GAM39709.1| hypothetical protein TCE0_034r11471 [Talaromyces... 69 1e-09 ref|XP_002479885.1| conserved hypothetical protein [Talaromyces ... 69 1e-09 ref|XP_002143561.1| conserved hypothetical protein [Talaromyces ... 69 1e-09 gb|EFW20647.1| conserved hypothetical protein [Coccidioides posa... 68 3e-09 gb|KIW65462.1| hypothetical protein PV04_07720 [Capronia semiimm... 67 5e-09 ref|XP_013313707.1| hypothetical protein PV05_08718 [Exophiala x... 67 5e-09 gb|KIW46698.1| hypothetical protein PV06_02346 [Exophiala oligos... 67 5e-09 gb|KIV96992.1| hypothetical protein PV10_00802 [Exophiala mesoph... 67 5e-09 gb|KKY17680.1| hypothetical protein UCRPC4_g05313 [Phaeomoniella... 67 7e-09 gb|KLJ09433.1| hypothetical protein EMPG_15143 [Emmonsia parva U... 66 9e-09 gb|KDB20299.1| hypothetical protein H109_07744 [Trichophyton int... 66 9e-09 gb|EEH08481.1| conserved hypothetical protein [Histoplasma capsu... 66 9e-09 gb|EZF30957.1| hypothetical protein H101_05411 [Trichophyton int... 66 9e-09 gb|EQL31285.1| hypothetical protein BDFG_06343 [Blastomyces derm... 66 9e-09 gb|EGE03853.1| hypothetical protein TEQG_02887 [Trichophyton equ... 66 9e-09 ref|XP_003236053.1| hypothetical protein TERG_03103 [Trichophyto... 66 9e-09 ref|XP_003169877.1| hypothetical protein MGYG_08047 [Microsporum... 66 9e-09 gb|EER42454.1| conserved hypothetical protein [Histoplasma capsu... 66 9e-09 ref|XP_002626950.1| conserved hypothetical protein [Blastomyces ... 66 9e-09 >ref|XP_013325514.1| hypothetical protein T310_7142 [Rasamsonia emersonii CBS 393.64] gi|802088960|gb|KKA18902.1| hypothetical protein T310_7142 [Rasamsonia emersonii CBS 393.64] Length = 254 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EMEIGGKLFFDLFVAMSNHIDD+VEISN RSPK+I Sbjct: 220 EMEIGGKLFFDLFVAMSNHIDDLVEISNGRSPKVI 254 >dbj|GAM39709.1| hypothetical protein TCE0_034r11471 [Talaromyces cellulolyticus] Length = 267 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EMEIGGKLFFDLFVAMSNHIDDIVEI NSRSPK I Sbjct: 233 EMEIGGKLFFDLFVAMSNHIDDIVEIGNSRSPKFI 267 >ref|XP_002479885.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] gi|218720032|gb|EED19451.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500] Length = 266 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EMEIGGKLFFDLFVAMSNHIDDIVEI NSRSPK I Sbjct: 232 EMEIGGKLFFDLFVAMSNHIDDIVEIGNSRSPKFI 266 >ref|XP_002143561.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] gi|210072959|gb|EEA27046.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224] gi|679996894|gb|KFX49242.1| Kelch-like protein 38 [Talaromyces marneffei PM1] gi|679996895|gb|KFX49243.1| Kelch-like protein 38 [Talaromyces marneffei PM1] Length = 267 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EMEIGGKLFFDLFVAMSNHIDDIVEI NSRSPK I Sbjct: 233 EMEIGGKLFFDLFVAMSNHIDDIVEIGNSRSPKFI 267 >gb|EFW20647.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] Length = 267 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDDIVEISNSRSPK+I Sbjct: 233 EMETGGKLFFDLFVAMCNHIDDIVEISNSRSPKVI 267 >gb|KIW65462.1| hypothetical protein PV04_07720 [Capronia semiimmersa] Length = 276 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDDIVEISNSRSPK+I Sbjct: 242 EMENGGKLFFDLFVAMCNHIDDIVEISNSRSPKVI 276 >ref|XP_013313707.1| hypothetical protein PV05_08718 [Exophiala xenobiotica] gi|759276615|gb|KIW53122.1| hypothetical protein PV05_08718 [Exophiala xenobiotica] Length = 274 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDDIVEISNSRSPK+I Sbjct: 240 EMEHGGKLFFDLFVAMCNHIDDIVEISNSRSPKVI 274 >gb|KIW46698.1| hypothetical protein PV06_02346 [Exophiala oligosperma] Length = 273 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDDIVEISNSRSPK+I Sbjct: 239 EMEHGGKLFFDLFVAMCNHIDDIVEISNSRSPKVI 273 >gb|KIV96992.1| hypothetical protein PV10_00802 [Exophiala mesophila] Length = 272 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDDIVEISNSRSPK+I Sbjct: 238 EMEEGGKLFFDLFVAMCNHIDDIVEISNSRSPKVI 272 >gb|KKY17680.1| hypothetical protein UCRPC4_g05313 [Phaeomoniella chlamydospora] Length = 271 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDDIVEISNSRSPK+I Sbjct: 237 EMENGGKLFFDLFVAMCNHIDDIVEISNSRSPKLI 271 >gb|KLJ09433.1| hypothetical protein EMPG_15143 [Emmonsia parva UAMH 139] Length = 267 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDDIVEISN+RSPK+I Sbjct: 233 EMESGGKLFFDLFVAMCNHIDDIVEISNNRSPKVI 267 >gb|KDB20299.1| hypothetical protein H109_07744 [Trichophyton interdigitale MR816] Length = 267 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDD+VE+SNSRSPK+I Sbjct: 233 EMESGGKLFFDLFVAMCNHIDDVVELSNSRSPKVI 267 >gb|EEH08481.1| conserved hypothetical protein [Histoplasma capsulatum G186AR] Length = 267 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDDIVEISN+RSPK+I Sbjct: 233 EMESGGKLFFDLFVAMCNHIDDIVEISNNRSPKVI 267 >gb|EZF30957.1| hypothetical protein H101_05411 [Trichophyton interdigitale H6] Length = 267 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDD+VE+SNSRSPK+I Sbjct: 233 EMESGGKLFFDLFVAMCNHIDDVVELSNSRSPKVI 267 >gb|EQL31285.1| hypothetical protein BDFG_06343 [Blastomyces dermatitidis ATCC 26199] Length = 267 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDDIVEISN+RSPK+I Sbjct: 233 EMESGGKLFFDLFVAMCNHIDDIVEISNNRSPKVI 267 >gb|EGE03853.1| hypothetical protein TEQG_02887 [Trichophyton equinum CBS 127.97] Length = 267 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDDIVE+SNSRSPK+I Sbjct: 233 EMENGGKLFFDLFVAMCNHIDDIVELSNSRSPKVI 267 >ref|XP_003236053.1| hypothetical protein TERG_03103 [Trichophyton rubrum CBS 118892] gi|607873851|gb|EZF19054.1| hypothetical protein H100_05381 [Trichophyton rubrum MR850] gi|607903210|gb|EZF40718.1| hypothetical protein H102_05346 [Trichophyton rubrum CBS 100081] gi|607915308|gb|EZF51349.1| hypothetical protein H103_05372 [Trichophyton rubrum CBS 288.86] gi|607927326|gb|EZF61935.1| hypothetical protein H104_05362 [Trichophyton rubrum CBS 289.86] gi|607939267|gb|EZF72570.1| hypothetical protein H105_05390 [Trichophyton soudanense CBS 452.61] gi|607951309|gb|EZF83254.1| hypothetical protein H110_05368 [Trichophyton rubrum MR1448] gi|607963480|gb|EZF93962.1| hypothetical protein H113_05407 [Trichophyton rubrum MR1459] gi|607975737|gb|EZG04960.1| hypothetical protein H106_05209 [Trichophyton rubrum CBS 735.88] gi|607987468|gb|EZG15513.1| hypothetical protein H107_05503 [Trichophyton rubrum CBS 202.88] gi|633057519|gb|KDB32454.1| hypothetical protein H112_05363 [Trichophyton rubrum D6] gi|861298848|gb|KMQ43200.1| BTB/POZ fold [Trichophyton rubrum] Length = 267 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDD+VE+SNSRSPK+I Sbjct: 233 EMESGGKLFFDLFVAMCNHIDDVVELSNSRSPKVI 267 >ref|XP_003169877.1| hypothetical protein MGYG_08047 [Microsporum gypseum CBS 118893] gi|311345839|gb|EFR05042.1| hypothetical protein MGYG_08047 [Microsporum gypseum CBS 118893] Length = 267 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDD+VE+SNSRSPK+I Sbjct: 233 EMESGGKLFFDLFVAMCNHIDDVVELSNSRSPKVI 267 >gb|EER42454.1| conserved hypothetical protein [Histoplasma capsulatum H143] gi|325090208|gb|EGC43518.1| conserved hypothetical protein [Histoplasma capsulatum H88] Length = 267 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDDIVEISN+RSPK+I Sbjct: 233 EMESGGKLFFDLFVAMCNHIDDIVEISNNRSPKVI 267 >ref|XP_002626950.1| conserved hypothetical protein [Blastomyces gilchristii SLH14081] gi|239594022|gb|EEQ76603.1| conserved hypothetical protein [Blastomyces gilchristii SLH14081] gi|239607104|gb|EEQ84091.1| conserved hypothetical protein [Blastomyces dermatitidis ER-3] gi|327351056|gb|EGE79913.1| hypothetical protein BDDG_02854 [Blastomyces dermatitidis ATCC 18188] Length = 267 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 370 EMEIGGKLFFDLFVAMSNHIDDIVEISNSRSPKII 266 EME GGKLFFDLFVAM NHIDDIVEISN+RSPK+I Sbjct: 233 EMESGGKLFFDLFVAMCNHIDDIVEISNNRSPKVI 267