BLASTX nr result
ID: Ophiopogon21_contig00045106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00045106 (360 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX77638.1| Mep3p [Rhizophagus irregularis DAOM 197198w] 84 5e-14 gb|ESA03014.1| hypothetical protein GLOINDRAFT_337025 [Rhizophag... 84 5e-14 emb|CAI54276.1| ammonium transporter 1 [Rhizophagus intraradices] 77 5e-12 >gb|EXX77638.1| Mep3p [Rhizophagus irregularis DAOM 197198w] Length = 90 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -1 Query: 360 DEAELGELAYYHVDRLITVNTRTGETKSIKEETVHQSNDTNVTIV 226 DE ELGELAYYHVDRL+ VNTRTGETK++KEET+HQ NDTN TIV Sbjct: 46 DETELGELAYYHVDRLVAVNTRTGETKTVKEETIHQQNDTNATIV 90 >gb|ESA03014.1| hypothetical protein GLOINDRAFT_337025 [Rhizophagus irregularis DAOM 181602] gi|595445400|gb|EXX56024.1| Mep2p [Rhizophagus irregularis DAOM 197198w] Length = 479 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -1 Query: 360 DEAELGELAYYHVDRLITVNTRTGETKSIKEETVHQSNDTNVTIV 226 DE ELGELAYYHVDRL+ VNTRTGETK++KEET+HQ NDTN TIV Sbjct: 435 DETELGELAYYHVDRLVAVNTRTGETKTVKEETIHQQNDTNATIV 479 >emb|CAI54276.1| ammonium transporter 1 [Rhizophagus intraradices] Length = 479 Score = 77.0 bits (188), Expect = 5e-12 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -1 Query: 360 DEAELGELAYYHVDRLITVNTRTGETKSIKEETVHQSNDTNVTIV 226 DE ELGELAYYHVDRL+ VNTRTGETK +KEET+ Q ND N TIV Sbjct: 435 DETELGELAYYHVDRLVAVNTRTGETKPVKEETIPQQNDANATIV 479