BLASTX nr result
ID: Ophiopogon21_contig00045042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00045042 (325 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERZ96561.1| hypothetical protein GLOINDRAFT_301052 [Rhizophag... 87 6e-15 gb|EXX59025.1| dynein intermediate chain [Rhizophagus irregulari... 64 4e-08 gb|ESA02353.1| hypothetical protein GLOINDRAFT_333779 [Rhizophag... 64 4e-08 gb|KFH66746.1| dynein intermediate chain, cytosolic [Mortierella... 60 6e-07 >gb|ERZ96561.1| hypothetical protein GLOINDRAFT_301052 [Rhizophagus irregularis DAOM 181602] gi|595446396|gb|EXX56571.1| dynein intermediate chain [Rhizophagus irregularis DAOM 197198w] Length = 634 Score = 86.7 bits (213), Expect = 6e-15 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -1 Query: 268 VQGTRFIPNFTTFEAVILDLPPKEIVFYNKEVQTKDTSFEPPPPS 134 +Q +RFIPNF TFEAVILD+PPKEIV YNKEVQTKDTSFEPPPPS Sbjct: 107 IQASRFIPNFITFEAVILDIPPKEIVHYNKEVQTKDTSFEPPPPS 151 >gb|EXX59025.1| dynein intermediate chain [Rhizophagus irregularis DAOM 197198w] Length = 509 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/42 (61%), Positives = 37/42 (88%) Frame = -1 Query: 259 TRFIPNFTTFEAVILDLPPKEIVFYNKEVQTKDTSFEPPPPS 134 +R+IP+F++FEAVILD+ PKE++ Y+KEVQT + SF PPPP+ Sbjct: 115 SRYIPDFSSFEAVILDIAPKELILYSKEVQTTERSFGPPPPN 156 >gb|ESA02353.1| hypothetical protein GLOINDRAFT_333779 [Rhizophagus irregularis DAOM 181602] gi|595451168|gb|EXX59024.1| dynein intermediate chain [Rhizophagus irregularis DAOM 197198w] Length = 639 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/42 (61%), Positives = 37/42 (88%) Frame = -1 Query: 259 TRFIPNFTTFEAVILDLPPKEIVFYNKEVQTKDTSFEPPPPS 134 +R+IP+F++FEAVILD+ PKE++ Y+KEVQT + SF PPPP+ Sbjct: 115 SRYIPDFSSFEAVILDIAPKELILYSKEVQTTERSFGPPPPN 156 >gb|KFH66746.1| dynein intermediate chain, cytosolic [Mortierella verticillata NRRL 6337] Length = 632 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -1 Query: 262 GTRFIPNFTTFEAVILDLPPKEIVFYNKEVQTKDTSFEPPPPS 134 G R IP FT+ EAVI D+PPKE V YNKEVQT + SFEP P+ Sbjct: 108 GNRLIPEFTSVEAVIFDIPPKERVVYNKEVQTVEGSFEPQGPT 150