BLASTX nr result
ID: Ophiopogon21_contig00045038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00045038 (420 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_962707.1| hypothetical protein NCU08037 [Neurospora crass... 95 2e-17 gb|EQB49756.1| hypothetical protein CGLO_10874 [Colletotrichum g... 95 2e-17 ref|XP_007272525.1| hypothetical protein CGGC5_15116 [Colletotri... 95 2e-17 ref|XP_009849761.1| hypothetical protein NEUTE1DRAFT_145531 [Neu... 95 2e-17 ref|XP_008097153.1| hypothetical protein GLRG_08277 [Colletotric... 94 4e-17 ref|XP_001910279.1| hypothetical protein [Podospora anserina S m... 94 4e-17 emb|CRK27814.1| hypothetical protein BN1708_004478 [Verticillium... 93 7e-17 gb|KDN69218.1| hypothetical protein CSUB01_07145 [Colletotrichum... 93 7e-17 ref|XP_003001181.1| conserved hypothetical protein [Verticillium... 93 7e-17 ref|XP_007600476.1| hypothetical protein CFIO01_00517 [Colletotr... 93 7e-17 emb|CCF32195.1| hypothetical protein CH063_04620 [Colletotrichum... 93 7e-17 ref|XP_009657978.1| hypothetical protein VDAG_10421 [Verticilliu... 93 7e-17 ref|XP_003715278.1| hypothetical protein MGG_07088 [Magnaporthe ... 90 6e-16 ref|XP_003347698.1| hypothetical protein SMAC_03796 [Sordaria ma... 90 8e-16 ref|XP_007911343.1| hypothetical protein UCRPA7_558 [Togninia mi... 89 2e-15 ref|XP_014173722.1| c6 zinc finger domain containing protein [Gr... 87 4e-15 gb|KIH92238.1| hypothetical protein SPBR_03333 [Sporothrix brasi... 87 5e-15 gb|ERT00803.1| hypothetical protein HMPREF1624_02036 [Sporothrix... 87 5e-15 gb|EPE10772.1| c6 zinc finger domain containing protein [Ophiost... 87 6e-15 gb|KLU85957.1| hypothetical protein MAPG_04976 [Magnaporthiopsis... 86 1e-14 >ref|XP_962707.1| hypothetical protein NCU08037 [Neurospora crassa OR74A] gi|28924318|gb|EAA33471.1| hypothetical protein NCU08037 [Neurospora crassa OR74A] gi|39979164|emb|CAE85537.1| putative protein [Neurospora crassa] gi|725981271|gb|KHE84396.1| hypothetical protein GE21DRAFT_6264 [Neurospora crassa] Length = 116 Score = 94.7 bits (234), Expect = 2e-17 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGY 206 EWDASKVPPSRFQKRKGSIYAVP +RDGHVDNNY T FH+KH+EKGY Sbjct: 66 EWDASKVPPSRFQKRKGSIYAVPKTRDGHVDNNYPTAFHQKHMEKGY 112 >gb|EQB49756.1| hypothetical protein CGLO_10874 [Colletotrichum gloeosporioides Cg-14] Length = 95 Score = 94.7 bits (234), Expect = 2e-17 Identities = 42/47 (89%), Positives = 42/47 (89%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGY 206 EWDASKVPPSRFQKRKGSIYA PGSRDGHVD NY T FHEKH EKGY Sbjct: 43 EWDASKVPPSRFQKRKGSIYATPGSRDGHVDRNYATGFHEKHTEKGY 89 >ref|XP_007272525.1| hypothetical protein CGGC5_15116 [Colletotrichum gloeosporioides Nara gc5] gi|429864040|gb|ELA38424.1| hypothetical protein CGGC5_15116 [Colletotrichum gloeosporioides Nara gc5] Length = 95 Score = 94.7 bits (234), Expect = 2e-17 Identities = 42/47 (89%), Positives = 42/47 (89%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGY 206 EWDASKVPPSRFQKRKGSIYA PGSRDGHVD NY T FHEKH EKGY Sbjct: 43 EWDASKVPPSRFQKRKGSIYATPGSRDGHVDRNYATGFHEKHTEKGY 89 >ref|XP_009849761.1| hypothetical protein NEUTE1DRAFT_145531 [Neurospora tetrasperma FGSC 2508] gi|336471377|gb|EGO59538.1| hypothetical protein NEUTE1DRAFT_145531 [Neurospora tetrasperma FGSC 2508] gi|350292474|gb|EGZ73669.1| hypothetical protein NEUTE2DRAFT_149671 [Neurospora tetrasperma FGSC 2509] Length = 116 Score = 94.7 bits (234), Expect = 2e-17 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGY 206 EWDASKVPPSRFQKRKGSIYAVP +RDGHVDNNY T FH+KH+EKGY Sbjct: 66 EWDASKVPPSRFQKRKGSIYAVPKTRDGHVDNNYATAFHQKHMEKGY 112 >ref|XP_008097153.1| hypothetical protein GLRG_08277 [Colletotrichum graminicola M1.001] gi|310798240|gb|EFQ33133.1| hypothetical protein GLRG_08277 [Colletotrichum graminicola M1.001] Length = 95 Score = 94.0 bits (232), Expect = 4e-17 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGY 206 EWDASKVPPSRFQKRKGSIYA PGSRDGHVD NY + FHEKH EKGY Sbjct: 43 EWDASKVPPSRFQKRKGSIYATPGSRDGHVDRNYASSFHEKHTEKGY 89 >ref|XP_001910279.1| hypothetical protein [Podospora anserina S mat+] gi|170945302|emb|CAP71414.1| unnamed protein product [Podospora anserina S mat+] gi|681101280|emb|CDP30812.1| Putative protein of unknown function [Podospora anserina S mat+] Length = 101 Score = 94.0 bits (232), Expect = 4e-17 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGY 206 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVD+NY KFHE H EKGY Sbjct: 38 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDSNYAHKFHELHAEKGY 84 >emb|CRK27814.1| hypothetical protein BN1708_004478 [Verticillium longisporum] Length = 107 Score = 93.2 bits (230), Expect = 7e-17 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGY 206 EWDASKVPPSRFQKRKGSIYA PGSRDGHVD NY + FHEKH EKGY Sbjct: 54 EWDASKVPPSRFQKRKGSIYATPGSRDGHVDRNYASGFHEKHTEKGY 100 >gb|KDN69218.1| hypothetical protein CSUB01_07145 [Colletotrichum sublineola] Length = 117 Score = 93.2 bits (230), Expect = 7e-17 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGY 206 EWDASKVPPSRFQKRKGSIYA PGSRDGHVD NY + FHEKH EKGY Sbjct: 65 EWDASKVPPSRFQKRKGSIYATPGSRDGHVDRNYASGFHEKHTEKGY 111 >ref|XP_003001181.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] gi|261359688|gb|EEY22116.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] Length = 100 Score = 93.2 bits (230), Expect = 7e-17 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGY 206 EWDASKVPPSRFQKRKGSIYA PGSRDGHVD NY + FHEKH EKGY Sbjct: 47 EWDASKVPPSRFQKRKGSIYATPGSRDGHVDRNYASGFHEKHTEKGY 93 >ref|XP_007600476.1| hypothetical protein CFIO01_00517 [Colletotrichum fioriniae PJ7] gi|588893967|gb|EXF76032.1| hypothetical protein CFIO01_00517 [Colletotrichum fioriniae PJ7] Length = 114 Score = 93.2 bits (230), Expect = 7e-17 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGY 206 EWDASKVPPSRFQKRKGSIYA PGSRDGHVD NY + FHEKH EKGY Sbjct: 62 EWDASKVPPSRFQKRKGSIYATPGSRDGHVDRNYASGFHEKHTEKGY 108 >emb|CCF32195.1| hypothetical protein CH063_04620 [Colletotrichum higginsianum] Length = 95 Score = 93.2 bits (230), Expect = 7e-17 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGY 206 EWDASKVPPSRFQKRKGSIYA PGSRDGHVD NY + FHEKH EKGY Sbjct: 43 EWDASKVPPSRFQKRKGSIYATPGSRDGHVDRNYASGFHEKHTEKGY 89 >ref|XP_009657978.1| hypothetical protein VDAG_10421 [Verticillium dahliae VdLs.17] gi|346977340|gb|EGY20792.1| hypothetical protein VDAG_10421 [Verticillium dahliae VdLs.17] gi|913773661|emb|CRK29695.1| hypothetical protein BN1708_015642 [Verticillium longisporum] gi|913821299|emb|CRK40320.1| hypothetical protein BN1723_004756 [Verticillium longisporum] Length = 100 Score = 93.2 bits (230), Expect = 7e-17 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGY 206 EWDASKVPPSRFQKRKGSIYA PGSRDGHVD NY + FHEKH EKGY Sbjct: 47 EWDASKVPPSRFQKRKGSIYATPGSRDGHVDRNYASGFHEKHTEKGY 93 >ref|XP_003715278.1| hypothetical protein MGG_07088 [Magnaporthe oryzae 70-15] gi|351647611|gb|EHA55471.1| hypothetical protein MGG_07088 [Magnaporthe oryzae 70-15] gi|440466158|gb|ELQ35440.1| hypothetical protein OOU_Y34scaffold00707g24 [Magnaporthe oryzae Y34] gi|440480671|gb|ELQ61324.1| hypothetical protein OOW_P131scaffold01192g38 [Magnaporthe oryzae P131] Length = 104 Score = 90.1 bits (222), Expect = 6e-16 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGY 206 EWDASKVPPSRFQKRKGSIY+ PGSRDGHVD N Q KFHE H EKGY Sbjct: 54 EWDASKVPPSRFQKRKGSIYSTPGSRDGHVDRNTQHKFHETHAEKGY 100 >ref|XP_003347698.1| hypothetical protein SMAC_03796 [Sordaria macrospora k-hell] gi|380091232|emb|CCC11089.1| unnamed protein product [Sordaria macrospora k-hell] Length = 130 Score = 89.7 bits (221), Expect = 8e-16 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGY 206 EWDASKVPPSRFQKRKGSIYAVP +RDGHVD NY FH+KH+EKGY Sbjct: 80 EWDASKVPPSRFQKRKGSIYAVPKTRDGHVDTNYAHAFHQKHMEKGY 126 >ref|XP_007911343.1| hypothetical protein UCRPA7_558 [Togninia minima UCRPA7] gi|500261402|gb|EOO03775.1| hypothetical protein UCRPA7_558 [Phaeoacremonium minimum UCRPA7] Length = 94 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGY 206 EWDASKVPPSRFQKRKGSIYAVP SRDGHV+NNY +K+HEK EKG+ Sbjct: 38 EWDASKVPPSRFQKRKGSIYAVPASRDGHVENNYASKYHEKLAEKGW 84 >ref|XP_014173722.1| c6 zinc finger domain containing protein [Grosmannia clavigera kw1407] gi|320591801|gb|EFX04240.1| c6 zinc finger domain containing protein [Grosmannia clavigera kw1407] Length = 1188 Score = 87.4 bits (215), Expect = 4e-15 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGYD 203 EWDASKVPPSRFQKRKGSIY+ P SRDG VD+NY KFH KH EKGY+ Sbjct: 1139 EWDASKVPPSRFQKRKGSIYSTPNSRDGQVDSNYAAKFHAKHAEKGYN 1186 >gb|KIH92238.1| hypothetical protein SPBR_03333 [Sporothrix brasiliensis 5110] Length = 143 Score = 87.0 bits (214), Expect = 5e-15 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGYD 203 EWDASKVPPSRFQKRKGSIY+ GSRDGHVD+NY KFH KH E GY+ Sbjct: 93 EWDASKVPPSRFQKRKGSIYSTQGSRDGHVDSNYAAKFHAKHAELGYN 140 >gb|ERT00803.1| hypothetical protein HMPREF1624_02036 [Sporothrix schenckii ATCC 58251] gi|780597346|gb|KJR87892.1| hypothetical protein SPSK_08097 [Sporothrix schenckii 1099-18] Length = 143 Score = 87.0 bits (214), Expect = 5e-15 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGYD 203 EWDASKVPPSRFQKRKGSIY+ GSRDGHVD+NY KFH KH E GY+ Sbjct: 93 EWDASKVPPSRFQKRKGSIYSTQGSRDGHVDSNYAAKFHAKHAELGYN 140 >gb|EPE10772.1| c6 zinc finger domain containing protein [Ophiostoma piceae UAMH 11346] Length = 149 Score = 86.7 bits (213), Expect = 6e-15 Identities = 38/48 (79%), Positives = 40/48 (83%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEKGYD 203 EWDASKVPPSRFQKRKGSIY+ P SRDG VDNNY KFH KH E GY+ Sbjct: 100 EWDASKVPPSRFQKRKGSIYSTPNSRDGQVDNNYAAKFHAKHAELGYN 147 >gb|KLU85957.1| hypothetical protein MAPG_04976 [Magnaporthiopsis poae ATCC 64411] Length = 92 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = -3 Query: 346 EWDASKVPPSRFQKRKGSIYAVPGSRDGHVDNNYQTKFHEKHLEK 212 EWDASKVPPSRFQKRKGSIY+ PGSRDGHVD NY KFH+ H EK Sbjct: 43 EWDASKVPPSRFQKRKGSIYSTPGSRDGHVDRNYAAKFHDLHTEK 87