BLASTX nr result
ID: Ophiopogon21_contig00044490
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00044490 (506 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013344366.1| hypothetical protein AUEXF2481DRAFT_691941 [... 113 5e-23 gb|KEQ61616.1| ribosomal protein S14 [Aureobasidium melanogenum ... 113 6e-23 gb|KIY04062.1| 40S ribosomal protein S29 [Fonsecaea multimorphos... 112 8e-23 gb|EMF15239.1| 40S ribosomal protein S29 [Sphaerulina musiva SO2... 112 1e-22 gb|EME48012.1| hypothetical protein DOTSEDRAFT_21726 [Dothistrom... 112 1e-22 ref|XP_007674738.1| hypothetical protein BAUCODRAFT_155088 [Baud... 112 1e-22 gb|KIN04221.1| hypothetical protein OIDMADRAFT_18249 [Oidiodendr... 111 2e-22 ref|XP_008730373.1| 40S ribosomal protein S29 [Cladophialophora ... 111 2e-22 ref|XP_013432418.1| ribosomal protein S14 [Aureobasidium namibia... 111 2e-22 ref|XP_001595493.1| 40S ribosomal protein S29 [Sclerotinia scler... 111 2e-22 ref|XP_008025785.1| hypothetical protein SETTUDRAFT_163319 [Seto... 110 3e-22 ref|XP_007683501.1| hypothetical protein COCMIDRAFT_1391 [Bipola... 110 3e-22 ref|XP_001552520.1| 40S ribosomal protein S29 [Botrytis cinerea ... 110 3e-22 ref|XP_008078609.1| hypothetical protein GLAREA_10368 [Glarea lo... 110 4e-22 ref|XP_001391014.1| 40S ribosomal protein S29 [Aspergillus niger... 110 4e-22 ref|XP_007834635.1| 40S ribosomal protein S29 [Pestalotiopsis fi... 110 5e-22 ref|XP_008716681.1| 40S ribosomal protein S29 [Cyphellophora eur... 110 5e-22 ref|XP_003840039.1| hypothetical protein LEMA_P108250.1 [Leptosp... 109 7e-22 ref|XP_003299484.1| 40S ribosomal protein S29 [Pyrenophora teres... 109 7e-22 gb|KLU88382.1| 30S ribosomal protein S14p/S29e [Magnaporthiopsis... 108 1e-21 >ref|XP_013344366.1| hypothetical protein AUEXF2481DRAFT_691941 [Aureobasidium subglaciale EXF-2481] gi|662531107|gb|KEQ88480.1| ribosomal protein S14 [Aureobasidium pullulans EXF-150] gi|662538509|gb|KEQ95815.1| hypothetical protein AUEXF2481DRAFT_691941 [Aureobasidium subglaciale EXF-2481] Length = 56 Score = 113 bits (283), Expect = 5e-23 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW+SRPR +GKGSR CRVC+HKAGLIRKYG NICRQCFREKS+DIGFIKHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHKAGLIRKYGLNICRQCFREKSTDIGFIKHR 56 >gb|KEQ61616.1| ribosomal protein S14 [Aureobasidium melanogenum CBS 110374] Length = 56 Score = 113 bits (282), Expect = 6e-23 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW+SRPR +GKGSR CRVC+HKAGLIRKYG NICRQCFREKS+DIGF+KHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHKAGLIRKYGLNICRQCFREKSTDIGFVKHR 56 >gb|KIY04062.1| 40S ribosomal protein S29 [Fonsecaea multimorphosa CBS 102226] Length = 108 Score = 112 bits (281), Expect = 8e-23 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKH 262 MSHESVW+SRPRNFGKGSR+CRVC+HKAGLIRKYG NICRQCFREKS DIGFIK+ Sbjct: 1 MSHESVWYSRPRNFGKGSRSCRVCTHKAGLIRKYGLNICRQCFREKSQDIGFIKN 55 >gb|EMF15239.1| 40S ribosomal protein S29 [Sphaerulina musiva SO2202] Length = 56 Score = 112 bits (280), Expect = 1e-22 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW+SRPR +GKG+RACRVC+HKAGLIRKYG NICRQCFREKS+DIGF KHR Sbjct: 1 MSHESVWYSRPRTYGKGARACRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 56 >gb|EME48012.1| hypothetical protein DOTSEDRAFT_21726 [Dothistroma septosporum NZE10] Length = 56 Score = 112 bits (279), Expect = 1e-22 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW+SRPR++GKG+R CRVC+HKAGLIRKYG NICRQCFREKSSDIGF KHR Sbjct: 1 MSHESVWYSRPRSYGKGARECRVCTHKAGLIRKYGLNICRQCFREKSSDIGFTKHR 56 >ref|XP_007674738.1| hypothetical protein BAUCODRAFT_155088 [Baudoinia panamericana UAMH 10762] gi|449301790|gb|EMC97799.1| hypothetical protein BAUCODRAFT_155088 [Baudoinia panamericana UAMH 10762] Length = 56 Score = 112 bits (279), Expect = 1e-22 Identities = 47/56 (83%), Positives = 54/56 (96%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW+SRPRN+GKG+R+CRVC+H+AGLIRKYG NICRQCFREKS+DIGF KHR Sbjct: 1 MSHESVWYSRPRNYGKGARSCRVCTHQAGLIRKYGLNICRQCFREKSADIGFTKHR 56 >gb|KIN04221.1| hypothetical protein OIDMADRAFT_18249 [Oidiodendron maius Zn] Length = 56 Score = 111 bits (278), Expect = 2e-22 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW SRPR +GKG+RACRVC+HKAGLIRKYG NICRQCFREK+SDIGF+KHR Sbjct: 1 MSHESVWNSRPRTYGKGARACRVCTHKAGLIRKYGLNICRQCFREKASDIGFVKHR 56 >ref|XP_008730373.1| 40S ribosomal protein S29 [Cladophialophora carrionii CBS 160.54] gi|565932207|gb|ETI21492.1| 40S ribosomal protein S29 [Cladophialophora carrionii CBS 160.54] Length = 56 Score = 111 bits (278), Expect = 2e-22 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW+SRPR +GKGSR+CRVC+H AGLIRKYG NICRQCFREKS DIGFIKHR Sbjct: 1 MSHESVWYSRPRTYGKGSRSCRVCTHTAGLIRKYGLNICRQCFREKSQDIGFIKHR 56 >ref|XP_013432418.1| ribosomal protein S14 [Aureobasidium namibiae CBS 147.97] gi|662520342|gb|KEQ77900.1| ribosomal protein S14 [Aureobasidium namibiae CBS 147.97] Length = 56 Score = 111 bits (277), Expect = 2e-22 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW+SRPR +GKGSR CRVC+H AGLIRKYG NICRQCFREKS+DIGFIKHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHTAGLIRKYGLNICRQCFREKSTDIGFIKHR 56 >ref|XP_001595493.1| 40S ribosomal protein S29 [Sclerotinia sclerotiorum 1980 UF-70] gi|154701369|gb|EDO01108.1| 40S ribosomal protein S29 [Sclerotinia sclerotiorum 1980 UF-70] Length = 56 Score = 111 bits (277), Expect = 2e-22 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW SRPR +GKG+R CRVC+HKAGLIRKYG NICRQCFREK+SDIGF+KHR Sbjct: 1 MSHESVWMSRPRTYGKGARGCRVCTHKAGLIRKYGLNICRQCFREKASDIGFVKHR 56 >ref|XP_008025785.1| hypothetical protein SETTUDRAFT_163319 [Setosphaeria turcica Et28A] gi|482810546|gb|EOA87352.1| hypothetical protein SETTUDRAFT_163319 [Setosphaeria turcica Et28A] Length = 56 Score = 110 bits (276), Expect = 3e-22 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW+SRPR +GKGSR CRVC+H AGLIRKYG NICRQCFREKS+DIGF+KHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHPAGLIRKYGLNICRQCFREKSTDIGFVKHR 56 >ref|XP_007683501.1| hypothetical protein COCMIDRAFT_1391 [Bipolaris oryzae ATCC 44560] gi|628217756|ref|XP_007714314.1| hypothetical protein COCCADRAFT_6728 [Bipolaris zeicola 26-R-13] gi|928516878|ref|XP_014077236.1| hypothetical protein COCC4DRAFT_41909 [Bipolaris maydis ATCC 48331] gi|953427749|ref|XP_014555946.1| hypothetical protein COCVIDRAFT_27200 [Bipolaris victoriae FI3] gi|451995345|gb|EMD87813.1| hypothetical protein COCHEDRAFT_1216936 [Bipolaris maydis C5] gi|477586242|gb|ENI03327.1| hypothetical protein COCC4DRAFT_41909 [Bipolaris maydis ATCC 48331] gi|576917146|gb|EUC31379.1| hypothetical protein COCCADRAFT_6728 [Bipolaris zeicola 26-R-13] gi|576936494|gb|EUC49989.1| hypothetical protein COCMIDRAFT_1391 [Bipolaris oryzae ATCC 44560] gi|578488927|gb|EUN26365.1| hypothetical protein COCVIDRAFT_27200 [Bipolaris victoriae FI3] Length = 56 Score = 110 bits (276), Expect = 3e-22 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW+SRPR +GKGSR CRVC+H AGLIRKYG NICRQCFREKS+DIGF+KHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHPAGLIRKYGLNICRQCFREKSADIGFVKHR 56 >ref|XP_001552520.1| 40S ribosomal protein S29 [Botrytis cinerea B05.10] gi|347828118|emb|CCD43815.1| similar to 40S ribosomal protein S29 [Botrytis cinerea T4] Length = 56 Score = 110 bits (276), Expect = 3e-22 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW SRPR +GKGSR CRVC+HKAGLIRKYG NICRQCFREK++DIGF+KHR Sbjct: 1 MSHESVWMSRPRTYGKGSRECRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >ref|XP_008078609.1| hypothetical protein GLAREA_10368 [Glarea lozoyensis ATCC 20868] gi|512205853|gb|EPE34674.1| hypothetical protein GLAREA_10368 [Glarea lozoyensis ATCC 20868] Length = 56 Score = 110 bits (275), Expect = 4e-22 Identities = 47/56 (83%), Positives = 53/56 (94%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW SRPR +GKG+RACRVC+HKAGLIRKYG NICRQCFREK++DIGF+KHR Sbjct: 1 MSHESVWNSRPRTYGKGARACRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >ref|XP_001391014.1| 40S ribosomal protein S29 [Aspergillus niger CBS 513.88] gi|134075475|emb|CAK48036.1| unnamed protein product [Aspergillus niger] Length = 56 Score = 110 bits (275), Expect = 4e-22 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 M+HESVW+SRPR FGKGSR+CRVCSH+AGLIRKYG NICRQCFREKSSDIGF K+R Sbjct: 1 MTHESVWYSRPRKFGKGSRSCRVCSHRAGLIRKYGMNICRQCFREKSSDIGFHKYR 56 >ref|XP_007834635.1| 40S ribosomal protein S29 [Pestalotiopsis fici W106-1] gi|573060572|gb|ETS80334.1| 40S ribosomal protein S29 [Pestalotiopsis fici W106-1] Length = 56 Score = 110 bits (274), Expect = 5e-22 Identities = 47/56 (83%), Positives = 53/56 (94%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW SRPR++GKG+R CRVC+HKAGLIRKYG NICRQCFREKS+DIGF+KHR Sbjct: 1 MSHESVWNSRPRSYGKGARQCRVCTHKAGLIRKYGLNICRQCFREKSADIGFVKHR 56 >ref|XP_008716681.1| 40S ribosomal protein S29 [Cyphellophora europaea CBS 101466] gi|568119565|gb|ETN42172.1| 40S ribosomal protein S29 [Cyphellophora europaea CBS 101466] Length = 66 Score = 110 bits (274), Expect = 5e-22 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVWFSRPR++GKG+R CRVC+HKAGLIRKYG NICRQCFREKS+DIGFIK R Sbjct: 1 MSHESVWFSRPRSYGKGARGCRVCTHKAGLIRKYGLNICRQCFREKSTDIGFIKVR 56 >ref|XP_003840039.1| hypothetical protein LEMA_P108250.1 [Leptosphaeria maculans JN3] gi|312216610|emb|CBX96560.1| hypothetical protein LEMA_P108250.1 [Leptosphaeria maculans JN3] Length = 118 Score = 109 bits (273), Expect = 7e-22 Identities = 46/56 (82%), Positives = 52/56 (92%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW+SRPR +GKG+R CRVC+H AGLIRKYG NICRQCFREKS+DIGF+KHR Sbjct: 63 MSHESVWYSRPRTYGKGARECRVCTHPAGLIRKYGLNICRQCFREKSADIGFVKHR 118 >ref|XP_003299484.1| 40S ribosomal protein S29 [Pyrenophora teres f. teres 0-1] gi|311326818|gb|EFQ92418.1| hypothetical protein PTT_10485 [Pyrenophora teres f. teres 0-1] Length = 56 Score = 109 bits (273), Expect = 7e-22 Identities = 46/56 (82%), Positives = 52/56 (92%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW+SRPR +GKGSR CRVC+H AGLIRKYG NICRQCFREK++DIGF+KHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHPAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >gb|KLU88382.1| 30S ribosomal protein S14p/S29e [Magnaporthiopsis poae ATCC 64411] Length = 56 Score = 108 bits (271), Expect = 1e-21 Identities = 46/56 (82%), Positives = 54/56 (96%) Frame = -3 Query: 426 MSHESVWFSRPRNFGKGSRACRVCSHKAGLIRKYGFNICRQCFREKSSDIGFIKHR 259 MSHESVW SRPR++GKG+RACRVCSH+AGLIRKYG +ICRQCFREK++DIGF+KHR Sbjct: 1 MSHESVWNSRPRSYGKGARACRVCSHRAGLIRKYGLDICRQCFREKAADIGFVKHR 56