BLASTX nr result
ID: Ophiopogon21_contig00044483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00044483 (468 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIJ56511.1| hypothetical protein M422DRAFT_40137 [Sphaerobolu... 63 8e-08 ref|XP_008034743.1| hypothetical protein TRAVEDRAFT_18580 [Trame... 63 1e-07 gb|KIP12852.1| hypothetical protein PHLGIDRAFT_137661 [Phlebiops... 62 1e-07 emb|CDO74033.1| hypothetical protein BN946_scf185043.g83 [Tramet... 62 1e-07 gb|EMD40550.1| hypothetical protein CERSUDRAFT_80218 [Gelatopori... 62 1e-07 ref|XP_007767974.1| hypothetical protein CONPUDRAFT_136768 [Coni... 62 1e-07 gb|KIK08580.1| hypothetical protein K443DRAFT_84870 [Laccaria am... 62 2e-07 gb|KIM91044.1| hypothetical protein PILCRDRAFT_161716 [Piloderma... 61 3e-07 ref|XP_009544016.1| hypothetical protein HETIRDRAFT_311932 [Hete... 61 3e-07 ref|XP_007315473.1| hypothetical protein SERLADRAFT_460691 [Serp... 61 3e-07 ref|XP_007382184.1| hypothetical protein PUNSTDRAFT_51278 [Punct... 60 5e-07 ref|XP_012182117.1| predicted protein [Fibroporia radiculosa] gi... 60 6e-07 gb|KIM68743.1| hypothetical protein SCLCIDRAFT_7031 [Scleroderma... 60 8e-07 ref|XP_007364294.1| hypothetical protein DICSQDRAFT_34899, parti... 60 8e-07 ref|XP_001874710.1| predicted protein [Laccaria bicolor S238N-H8... 59 1e-06 ref|XP_007861613.1| hypothetical protein GLOTRDRAFT_11424, parti... 59 1e-06 ref|XP_007843236.1| hypothetical protein Moror_17663 [Moniliopht... 59 2e-06 gb|KIJ70302.1| hypothetical protein HYDPIDRAFT_77207 [Hydnomerul... 58 2e-06 ref|XP_001836965.1| hypothetical protein CC1G_00101 [Coprinopsis... 58 2e-06 gb|KJA24494.1| hypothetical protein HYPSUDRAFT_136094 [Hypholoma... 58 3e-06 >gb|KIJ56511.1| hypothetical protein M422DRAFT_40137 [Sphaerobolus stellatus SS14] Length = 470 Score = 63.2 bits (152), Expect = 8e-08 Identities = 32/44 (72%), Positives = 37/44 (84%), Gaps = 4/44 (9%) Frame = -1 Query: 141 PSPRASLLSGLRTGGVRSVS----VPHTAAPTGSFHVPRVPSSS 22 PS RASLL+GLRTGGVRSVS +PHTAAPTGSFH+PR S++ Sbjct: 7 PSNRASLLAGLRTGGVRSVSQPHQLPHTAAPTGSFHIPRYVSAN 50 >ref|XP_008034743.1| hypothetical protein TRAVEDRAFT_18580 [Trametes versicolor FP-101664 SS1] gi|392568911|gb|EIW62085.1| hypothetical protein TRAVEDRAFT_18580 [Trametes versicolor FP-101664 SS1] Length = 478 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 2/43 (4%) Frame = -1 Query: 156 MAAAQPSPRASLLSGLRTGGVRSVS--VPHTAAPTGSFHVPRV 34 MA P+PRASLL+GLRTGGVRS S +PHTAAP+G+F++PR+ Sbjct: 1 MATPAPNPRASLLAGLRTGGVRSASGPIPHTAAPSGTFNIPRI 43 >gb|KIP12852.1| hypothetical protein PHLGIDRAFT_137661 [Phlebiopsis gigantea 11061_1 CR5-6] Length = 448 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/41 (75%), Positives = 36/41 (87%), Gaps = 2/41 (4%) Frame = -1 Query: 153 AAAQPSPRASLLSGLRTGGVRSVS--VPHTAAPTGSFHVPR 37 A A P+PRA+LLSGLRTGGVRSVS VPHTAAP G+F++PR Sbjct: 3 ANATPNPRAALLSGLRTGGVRSVSGPVPHTAAPAGTFNIPR 43 >emb|CDO74033.1| hypothetical protein BN946_scf185043.g83 [Trametes cinnabarina] Length = 472 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/42 (69%), Positives = 36/42 (85%), Gaps = 2/42 (4%) Frame = -1 Query: 153 AAAQPSPRASLLSGLRTGGVRSVS--VPHTAAPTGSFHVPRV 34 A P+PRASLL+GLRTGGVRS S +PHTAAPTG+F++PR+ Sbjct: 3 ATPAPNPRASLLAGLRTGGVRSASGPIPHTAAPTGTFNIPRI 44 >gb|EMD40550.1| hypothetical protein CERSUDRAFT_80218 [Gelatoporia subvermispora B] Length = 490 Score = 62.4 bits (150), Expect = 1e-07 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 5/49 (10%) Frame = -1 Query: 156 MAAAQPSPRASLLSGLRTGGVRSVS-----VPHTAAPTGSFHVPRVPSS 25 MA P+PRASLLSGLRTGGVRSVS PHTAAP G F +PR+ S+ Sbjct: 1 MATPAPNPRASLLSGLRTGGVRSVSGPNNNAPHTAAPAGMFSIPRIVST 49 >ref|XP_007767974.1| hypothetical protein CONPUDRAFT_136768 [Coniophora puteana RWD-64-598 SS2] gi|392592915|gb|EIW82241.1| hypothetical protein CONPUDRAFT_136768 [Coniophora puteana RWD-64-598 SS2] Length = 511 Score = 62.4 bits (150), Expect = 1e-07 Identities = 35/52 (67%), Positives = 41/52 (78%), Gaps = 3/52 (5%) Frame = -1 Query: 156 MAAAQPS-PRASLLSGLRTGGVRSVS--VPHTAAPTGSFHVPRVPSSSVVYA 10 M+ A P+ PRASLLSGLRTGGVRS S VPHTA+ TGSF+VPR SS+ Y+ Sbjct: 1 MSTAPPANPRASLLSGLRTGGVRSTSMNVPHTASVTGSFNVPRFSSSNYQYS 52 >gb|KIK08580.1| hypothetical protein K443DRAFT_84870 [Laccaria amethystina LaAM-08-1] Length = 482 Score = 62.0 bits (149), Expect = 2e-07 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = -1 Query: 156 MAAAQPSPRASLLSGLRTGGVRSVS--VPHTAAPTGSFHVPRVPS 28 M A P+ RASLL+GLRTGGVRS S VPHTAAPTG+F+VPR S Sbjct: 1 MTTANPNNRASLLAGLRTGGVRSTSLNVPHTAAPTGAFYVPRFVS 45 >gb|KIM91044.1| hypothetical protein PILCRDRAFT_161716 [Piloderma croceum F 1598] Length = 486 Score = 61.2 bits (147), Expect = 3e-07 Identities = 34/51 (66%), Positives = 41/51 (80%), Gaps = 6/51 (11%) Frame = -1 Query: 156 MAAAQ-PSPRASLLSGLRTGGVRSVS-----VPHTAAPTGSFHVPRVPSSS 22 MA AQ P+PRASLLSGLRTGGVRS+S VP+TAAP G+F VPR+ S++ Sbjct: 1 MATAQIPNPRASLLSGLRTGGVRSMSGSMANVPYTAAPGGNFSVPRIASTT 51 >ref|XP_009544016.1| hypothetical protein HETIRDRAFT_311932 [Heterobasidion irregulare TC 32-1] gi|575068723|gb|ETW84335.1| hypothetical protein HETIRDRAFT_311932 [Heterobasidion irregulare TC 32-1] Length = 490 Score = 61.2 bits (147), Expect = 3e-07 Identities = 34/54 (62%), Positives = 38/54 (70%), Gaps = 5/54 (9%) Frame = -1 Query: 153 AAAQPSPRASLLSGLRTGGVRSVS-----VPHTAAPTGSFHVPRVPSSSVVYAH 7 AA P+PRASLL+GLRTGGVRS S VPHTAA SF VPR PSS+ +H Sbjct: 3 AAPAPNPRASLLAGLRTGGVRSTSGPMGNVPHTAAVGSSFSVPRYPSSTFHNSH 56 >ref|XP_007315473.1| hypothetical protein SERLADRAFT_460691 [Serpula lacrymans var. lacrymans S7.9] gi|336373406|gb|EGO01744.1| hypothetical protein SERLA73DRAFT_177212 [Serpula lacrymans var. lacrymans S7.3] gi|336386236|gb|EGO27382.1| hypothetical protein SERLADRAFT_460691 [Serpula lacrymans var. lacrymans S7.9] Length = 496 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/46 (67%), Positives = 38/46 (82%), Gaps = 2/46 (4%) Frame = -1 Query: 150 AAQPSPRASLLSGLRTGGVRSVS--VPHTAAPTGSFHVPRVPSSSV 19 A P+PRASLL+GLRTGGVRSVS +PHTAAP SF++PR S+S+ Sbjct: 4 APPPNPRASLLNGLRTGGVRSVSMNMPHTAAPGSSFNLPRFASNSI 49 >ref|XP_007382184.1| hypothetical protein PUNSTDRAFT_51278 [Punctularia strigosozonata HHB-11173 SS5] gi|390601278|gb|EIN10672.1| hypothetical protein PUNSTDRAFT_51278 [Punctularia strigosozonata HHB-11173 SS5] Length = 445 Score = 60.5 bits (145), Expect = 5e-07 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 5/50 (10%) Frame = -1 Query: 156 MAAAQPSP-RASLLSGLRTGGVRS----VSVPHTAAPTGSFHVPRVPSSS 22 MA AQ S RASLLSGLRTGGVRS ++VPHTAAPTGSF++PR S++ Sbjct: 1 MATAQASSNRASLLSGLRTGGVRSATNPMAVPHTAAPTGSFNIPRFASAT 50 >ref|XP_012182117.1| predicted protein [Fibroporia radiculosa] gi|403416134|emb|CCM02834.1| predicted protein [Fibroporia radiculosa] Length = 492 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/44 (65%), Positives = 36/44 (81%), Gaps = 5/44 (11%) Frame = -1 Query: 141 PSPRASLLSGLRTGGVRSVS-----VPHTAAPTGSFHVPRVPSS 25 P+PRASLL+GLRTGGVRS S VPHTAAP G+F++PR+ S+ Sbjct: 7 PNPRASLLAGLRTGGVRSASGPTGNVPHTAAPAGAFNIPRIVST 50 >gb|KIM68743.1| hypothetical protein SCLCIDRAFT_7031 [Scleroderma citrinum Foug A] Length = 492 Score = 59.7 bits (143), Expect = 8e-07 Identities = 30/49 (61%), Positives = 39/49 (79%), Gaps = 2/49 (4%) Frame = -1 Query: 150 AAQPSPRASLLSGLRTGGVR--SVSVPHTAAPTGSFHVPRVPSSSVVYA 10 A P+ RASLL+GLRTGGVR S+S PHTAAP GSF++PR S+S+ ++ Sbjct: 4 AHHPNHRASLLNGLRTGGVRATSMSAPHTAAPGGSFNIPRFTSTSIQHS 52 >ref|XP_007364294.1| hypothetical protein DICSQDRAFT_34899, partial [Dichomitus squalens LYAD-421 SS1] gi|395330565|gb|EJF62948.1| hypothetical protein DICSQDRAFT_34899, partial [Dichomitus squalens LYAD-421 SS1] Length = 458 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/45 (64%), Positives = 35/45 (77%), Gaps = 5/45 (11%) Frame = -1 Query: 153 AAAQPSPRASLLSGLRTGGVRSVS-----VPHTAAPTGSFHVPRV 34 A P+PRASLL+GLRTGGVRS S VPHTAAP G+F++PR+ Sbjct: 3 ATPAPNPRASLLAGLRTGGVRSASGSMPNVPHTAAPAGTFNIPRI 47 >ref|XP_001874710.1| predicted protein [Laccaria bicolor S238N-H82] gi|164649910|gb|EDR14151.1| predicted protein [Laccaria bicolor S238N-H82] Length = 482 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/45 (66%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = -1 Query: 156 MAAAQPSPRASLLSGLRTGGVR--SVSVPHTAAPTGSFHVPRVPS 28 M A P+ RASLL+GLRTGGVR S++VPHTAAPTG+F +PR S Sbjct: 1 MTTANPNNRASLLAGLRTGGVRTTSLNVPHTAAPTGAFTIPRFVS 45 >ref|XP_007861613.1| hypothetical protein GLOTRDRAFT_11424, partial [Gloeophyllum trabeum ATCC 11539] gi|521729818|gb|EPQ59903.1| hypothetical protein GLOTRDRAFT_11424, partial [Gloeophyllum trabeum ATCC 11539] Length = 490 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/40 (77%), Positives = 33/40 (82%), Gaps = 5/40 (12%) Frame = -1 Query: 141 PSPRASLLSGLRTGGVRSVS-----VPHTAAPTGSFHVPR 37 P+PRASLLSGLRTGGVRS S VPHTAAP GSF+VPR Sbjct: 7 PNPRASLLSGLRTGGVRSSSNPMQNVPHTAAPGGSFNVPR 46 >ref|XP_007843236.1| hypothetical protein Moror_17663 [Moniliophthora roreri MCA 2997] gi|554916435|gb|ESK97484.1| hypothetical protein Moror_17663 [Moniliophthora roreri MCA 2997] Length = 474 Score = 58.5 bits (140), Expect = 2e-06 Identities = 31/47 (65%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = -1 Query: 156 MAAAQPSPRASLLSGLRTGGVR--SVSVPHTAAPTGSFHVPRVPSSS 22 M+ A PS RASLLSGLRTGGVR S S+PHTAAP +F++PR S S Sbjct: 1 MSTAPPSNRASLLSGLRTGGVRSASASIPHTAAPGATFNIPRSISHS 47 >gb|KIJ70302.1| hypothetical protein HYDPIDRAFT_77207 [Hydnomerulius pinastri MD-312] Length = 493 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/40 (75%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = -1 Query: 132 RASLLSGLRTGGVRS--VSVPHTAAPTGSFHVPRVPSSSV 19 RASLL+GLRTGGVRS +SVPHTAAP GSF+VPR S+S+ Sbjct: 10 RASLLNGLRTGGVRSTSMSVPHTAAPGGSFNVPRFASTSI 49 >ref|XP_001836965.1| hypothetical protein CC1G_00101 [Coprinopsis cinerea okayama7#130] gi|116501687|gb|EAU84582.1| hypothetical protein CC1G_00101 [Coprinopsis cinerea okayama7#130] Length = 503 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/44 (70%), Positives = 35/44 (79%), Gaps = 2/44 (4%) Frame = -1 Query: 147 AQPSPRASLLSGLRTGGVRSVS--VPHTAAPTGSFHVPRVPSSS 22 A + RASLL+GLRTGGVRS S VPHTAAPTGSF++ R PS S Sbjct: 5 ANNNNRASLLAGLRTGGVRSASLNVPHTAAPTGSFNINRAPSYS 48 >gb|KJA24494.1| hypothetical protein HYPSUDRAFT_136094 [Hypholoma sublateritium FD-334 SS-4] Length = 506 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 2/42 (4%) Frame = -1 Query: 156 MAAAQPSPRASLLSGLRTGGVRSVS--VPHTAAPTGSFHVPR 37 M A + RASLL+GLRTGGVRSVS VPHTAAP G+F+VPR Sbjct: 1 MTTANANNRASLLAGLRTGGVRSVSGPVPHTAAPAGTFNVPR 42