BLASTX nr result
ID: Ophiopogon21_contig00044434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00044434 (459 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESA03164.1| hypothetical protein GLOINDRAFT_334115 [Rhizophag... 142 1e-31 >gb|ESA03164.1| hypothetical protein GLOINDRAFT_334115 [Rhizophagus irregularis DAOM 181602] gi|595479056|gb|EXX68199.1| hypothetical protein RirG_107160 [Rhizophagus irregularis DAOM 197198w] gi|595479057|gb|EXX68200.1| hypothetical protein RirG_107160 [Rhizophagus irregularis DAOM 197198w] Length = 551 Score = 142 bits (358), Expect = 1e-31 Identities = 91/155 (58%), Positives = 98/155 (63%), Gaps = 5/155 (3%) Frame = -3 Query: 457 IYLNEISTYPPWALLLVTLGIGSLVYGVLLLSASKEEPNXXXXXXXXXXXXXXXXENMHN 278 IYLNEISTYPPWALLLVTLGIGSLVYGVLLLSASKEEPN N Sbjct: 289 IYLNEISTYPPWALLLVTLGIGSLVYGVLLLSASKEEPN---TDSIDSEFDDEEGMKEEN 345 Query: 277 MLSAG-WDXXXXXXXXXXXXXXIGMLSG-GKE---TNGRKEKNLGDGRFFLNLKKSLNSR 113 MLSAG WD IGMLSG GKE +NG + K GDGRFF KKS S Sbjct: 346 MLSAGSWDATSTSGTNNSTGSHIGMLSGNGKENNKSNGERGKKFGDGRFFSISKKSSVSE 405 Query: 112 PGFFKMSLLKGGKNKGIRGLESTKDSYQNKDINNY 8 PGFF+MSLLKGGKNK +R E+T +S+ INNY Sbjct: 406 PGFFRMSLLKGGKNK-LRDFENTDESHH---INNY 436