BLASTX nr result
ID: Ophiopogon21_contig00044397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00044397 (447 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014567254.1| hypothetical protein L969DRAFT_87855 [Mixia ... 58 2e-06 dbj|GAA94643.1| hypothetical protein E5Q_01296 [Mixia osmundae I... 58 2e-06 gb|EMD32546.1| hypothetical protein CERSUDRAFT_87875 [Gelatopori... 58 3e-06 gb|KDE03148.1| hypothetical protein MVLG_06343 [Microbotryum lyc... 57 4e-06 ref|XP_007860867.1| hypothetical protein GLOTRDRAFT_135138 [Gloe... 57 7e-06 gb|EJU02565.1| hypothetical protein DACRYDRAFT_88363 [Dacryopina... 56 9e-06 ref|XP_007359868.1| hypothetical protein DICSQDRAFT_46920 [Dicho... 56 9e-06 >ref|XP_014567254.1| hypothetical protein L969DRAFT_87855 [Mixia osmundae IAM 14324] gi|658163927|gb|KEI38641.1| hypothetical protein L969DRAFT_87855 [Mixia osmundae IAM 14324] Length = 477 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -3 Query: 106 VQTKWLTFFLWQLASFGITMGYHRLWSHRAFKARL 2 ++T L FF WQLA +GITMGYHRLWSH+A++ARL Sbjct: 91 LKTAMLCFFSWQLAIYGITMGYHRLWSHKAYEARL 125 >dbj|GAA94643.1| hypothetical protein E5Q_01296 [Mixia osmundae IAM 14324] Length = 474 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = -3 Query: 106 VQTKWLTFFLWQLASFGITMGYHRLWSHRAFKARL 2 ++T L FF WQLA +GITMGYHRLWSH+A++ARL Sbjct: 88 LKTAMLCFFSWQLAIYGITMGYHRLWSHKAYEARL 122 >gb|EMD32546.1| hypothetical protein CERSUDRAFT_87875 [Gelatoporia subvermispora B] Length = 435 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 100 TKWLTFFLWQLASFGITMGYHRLWSHRAFKARL 2 T WLT F WQ +S G+T+GYHRL+SHRAF+ARL Sbjct: 45 TLWLTLFFWQASSIGVTVGYHRLYSHRAFRARL 77 >gb|KDE03148.1| hypothetical protein MVLG_06343 [Microbotryum lychnidis-dioicae p1A1 Lamole] Length = 495 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -3 Query: 100 TKWLTFFLWQLASFGITMGYHRLWSHRAFKA 8 T WL F WQLA+FGIT+GYHRLWSHR+F A Sbjct: 55 TMWLCFLSWQLATFGITIGYHRLWSHRSFTA 85 >ref|XP_007860867.1| hypothetical protein GLOTRDRAFT_135138 [Gloeophyllum trabeum ATCC 11539] gi|521730381|gb|EPQ60464.1| hypothetical protein GLOTRDRAFT_135138 [Gloeophyllum trabeum ATCC 11539] Length = 401 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -3 Query: 91 LTFFLWQLASFGITMGYHRLWSHRAFKAR 5 L F LWQLA FGIT+GYHRLWSHRAF+A+ Sbjct: 50 LAFVLWQLAEFGITIGYHRLWSHRAFRAK 78 >gb|EJU02565.1| hypothetical protein DACRYDRAFT_88363 [Dacryopinax sp. DJM-731 SS1] Length = 458 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -3 Query: 103 QTKWLTFFLWQLASFGITMGYHRLWSHRAFKARL 2 QT +L + WQLASFG+T+GYHRLWSH+ F ARL Sbjct: 63 QTLYLCIWSWQLASFGVTIGYHRLWSHKGFTARL 96 >ref|XP_007359868.1| hypothetical protein DICSQDRAFT_46920 [Dichomitus squalens LYAD-421 SS1] gi|395334899|gb|EJF67275.1| hypothetical protein DICSQDRAFT_46920 [Dichomitus squalens LYAD-421 SS1] Length = 417 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -3 Query: 103 QTKWLTFFLWQLASFGITMGYHRLWSHRAFKARL 2 Q+ WL FLWQ AS G+T+GYHRL+SHRAF+A L Sbjct: 42 QSLWLAVFLWQAASMGVTVGYHRLYSHRAFRATL 75