BLASTX nr result
ID: Ophiopogon21_contig00044355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00044355 (348 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EZF28226.1| hypothetical protein H101_08092 [Trichophyton int... 66 9e-09 ref|XP_001218184.1| predicted protein [Aspergillus terreus NIH26... 58 2e-06 >gb|EZF28226.1| hypothetical protein H101_08092 [Trichophyton interdigitale H6] Length = 274 Score = 66.2 bits (160), Expect = 9e-09 Identities = 38/94 (40%), Positives = 49/94 (52%), Gaps = 2/94 (2%) Frame = -3 Query: 277 TRIRGKRISTGMRVHVLAYLLNFSDDVTAFKAEFARLCETGAGALEVAHLCGCGTCRKDS 98 T ++ R+ST MRV LAYLLNF++ +F RLCE L V HLCGCG + Sbjct: 158 THMQTPRLSTKMRVATLAYLLNFANTPDKLAEQFRRLCED--RELFVLHLCGCGLSSRTK 215 Query: 97 EGRIV--EGCTIPSHLALVEKSVNDKHKYYHYVL 2 E + GC +HL L N H+ YHY + Sbjct: 216 EQHKIWYGGCCEKTHLQLGYNEENHAHRCYHYTI 249 >ref|XP_001218184.1| predicted protein [Aspergillus terreus NIH2624] gi|114188053|gb|EAU29753.1| predicted protein [Aspergillus terreus NIH2624] Length = 223 Score = 58.2 bits (139), Expect = 2e-06 Identities = 36/86 (41%), Positives = 46/86 (53%) Frame = -3 Query: 259 RISTGMRVHVLAYLLNFSDDVTAFKAEFARLCETGAGALEVAHLCGCGTCRKDSEGRIVE 80 R+ST +RV LAYL F+DD+ + EF L + + V HLCGCG C K + G+ V Sbjct: 115 RVSTKIRVATLAYLWKFADDLDDLRREFYILKDLPPD-IGVLHLCGCGLCVK-ANGKDVL 172 Query: 79 GCTIPSHLALVEKSVNDKHKYYHYVL 2 GC HL L N HK H +L Sbjct: 173 GCCQKEHLILGSLENNMDHKVNHDML 198