BLASTX nr result
ID: Ophiopogon21_contig00044310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00044310 (390 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010924829.1| PREDICTED: uncharacterized protein LOC105047... 64 4e-08 >ref|XP_010924829.1| PREDICTED: uncharacterized protein LOC105047559 [Elaeis guineensis] Length = 108 Score = 63.9 bits (154), Expect = 4e-08 Identities = 38/89 (42%), Positives = 47/89 (52%), Gaps = 6/89 (6%) Frame = +3 Query: 75 DASYAWDLGSPLYDSFEIASFWHILDRKLMLLPFSSRS------FQRLTTKQTGKPRGEQ 236 DA WD GSPLYDSFE+AS H+LDR M LPFS S F + G+ R Sbjct: 19 DAVPIWDCGSPLYDSFELASLCHLLDRHQMTLPFSKESVRFSGRFCDEPDEMLGEQRMVA 78 Query: 237 GKEISKTTKRKSSKGLQGIYYHAIALWMK 323 G+ +K +K SKG + AIA W + Sbjct: 79 GRRGTKEKAKKRSKGGLRSMFTAIAFWRR 107