BLASTX nr result
ID: Ophiopogon21_contig00044036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00044036 (318 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESA05763.1| hypothetical protein GLOINDRAFT_350018 [Rhizophag... 76 9e-12 >gb|ESA05763.1| hypothetical protein GLOINDRAFT_350018 [Rhizophagus irregularis DAOM 181602] gi|595482763|gb|EXX70319.1| hypothetical protein RirG_088510 [Rhizophagus irregularis DAOM 197198w] Length = 224 Score = 76.3 bits (186), Expect = 9e-12 Identities = 38/56 (67%), Positives = 47/56 (83%), Gaps = 2/56 (3%) Frame = -1 Query: 258 STFPPLQKAVKLSTSLICNRPAKEIRIYLNDLINSINKQFSI--SIPKRRASFSAK 97 S FPPLQKA+KLS++L+C+R EIR LN+LINSINKQ S+ S+PKRRASFSA+ Sbjct: 11 SNFPPLQKAIKLSSNLVCDRSTSEIRNCLNELINSINKQLSVISSLPKRRASFSAR 66