BLASTX nr result
ID: Ophiopogon21_contig00044020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00044020 (382 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIO28886.1| hypothetical protein M407DRAFT_175589 [Tulasnella... 79 1e-12 >gb|KIO28886.1| hypothetical protein M407DRAFT_175589 [Tulasnella calospora MUT 4182] Length = 298 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = -3 Query: 380 HGPLVKATSTTITFPAAAAGHPRSISFQGPRFGWWGHGKPGRGC 249 HGP VKATSTTITFPAAAAGHPRSISF+GP GW+GHG+ G GC Sbjct: 225 HGPFVKATSTTITFPAAAAGHPRSISFRGPT-GWFGHGRFGHGC 267