BLASTX nr result
ID: Ophiopogon21_contig00043959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00043959 (386 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX71498.1| hypothetical protein RirG_078010 [Rhizophagus irr... 58 3e-06 >gb|EXX71498.1| hypothetical protein RirG_078010 [Rhizophagus irregularis DAOM 197198w] Length = 430 Score = 57.8 bits (138), Expect = 3e-06 Identities = 38/130 (29%), Positives = 59/130 (45%), Gaps = 2/130 (1%) Frame = +1 Query: 1 EERWLPNYNYSTPSENDKNTFVFRVVPKD--SGFQDDRGFSSPYFIVTGPDTVSSQGSAT 174 E W P+YN S P+EN K+TFVFRV+PK D S + + T+ S+ A+ Sbjct: 146 ESGWFPDYNNSIPNENSKHTFVFRVIPKGHYENLNLDIYKSKEFIAIESKPTLKSEPVAS 205 Query: 175 VAIASTYSPYSTTINIVSTVSVISADSKAQENDKSDNRAFIALISXXXXXXXXXXXXXXX 354 +++ + + T T + S D Q+ DKS+ F I+ Sbjct: 206 ISVKTVQAAAPTN---TVTPPINSGD---QKKDKSEKNVFNVFIAVASVAAFLAFIAIVI 259 Query: 355 XXRSRKRISN 384 R+RKR++N Sbjct: 260 AIRNRKRVNN 269