BLASTX nr result
ID: Ophiopogon21_contig00043903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00043903 (328 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESA01057.1| hypothetical protein GLOINDRAFT_263427 [Rhizophag... 83 9e-14 >gb|ESA01057.1| hypothetical protein GLOINDRAFT_263427 [Rhizophagus irregularis DAOM 181602] gi|595447942|gb|EXX57481.1| phosphatidate phosphatase APP1 [Rhizophagus irregularis DAOM 197198w] Length = 643 Score = 82.8 bits (203), Expect = 9e-14 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -3 Query: 149 TPLEMFHERLHLLKEGLPDDLFHTFTDSQELENDPAIKAALKY 21 TPLEMFHERL LL+EG+PDDLFHTFTD++ELE+DPAIKAALKY Sbjct: 601 TPLEMFHERLELLREGIPDDLFHTFTDAKELEDDPAIKAALKY 643