BLASTX nr result
ID: Ophiopogon21_contig00043832
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00043832 (491 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007673027.1| hypothetical protein BAUCODRAFT_30404 [Baudo... 65 2e-08 ref|XP_014172838.1| wsc domain protein [Grosmannia clavigera kw1... 65 3e-08 gb|KJR83523.1| cell wall integrity and stress response component... 63 1e-07 gb|KIH93908.1| cell wall integrity and stress response component... 63 1e-07 gb|ERS98866.1| hypothetical protein HMPREF1624_04056 [Sporothrix... 63 1e-07 ref|XP_007294675.1| WSC domain containing protein [Marssonina br... 62 2e-07 ref|XP_007931416.1| hypothetical protein MYCFIDRAFT_191065 [Pseu... 61 4e-07 gb|KJY02024.1| WSC domain containing protein [Zymoseptoria brevis] 60 5e-07 ref|XP_008711329.1| hypothetical protein HMPREF1541_00803 [Cyphe... 60 5e-07 gb|KIW02854.1| hypothetical protein PV09_05908 [Verruconis gallo... 60 8e-07 gb|KKY14700.1| putative wsc domain-containing protein [Diplodia ... 59 1e-06 gb|ESZ93607.1| hypothetical protein SBOR_6036 [Sclerotinia borea... 59 1e-06 ref|XP_007913692.1| putative wsc domain containing protein [Togn... 59 1e-06 gb|EPQ63644.1| hypothetical protein BGT96224_ASP20468 [Blumeria ... 59 2e-06 ref|XP_008086007.1| hypothetical protein GLAREA_02731 [Glarea lo... 58 2e-06 gb|EHL00872.1| putative Cell wall integrity and stress response ... 58 2e-06 gb|KIV96131.1| hypothetical protein PV10_00035 [Exophiala mesoph... 57 4e-06 ref|XP_003848577.1| hypothetical protein MYCGRDRAFT_106153 [Zymo... 57 4e-06 gb|EWY86391.1| hypothetical protein FOYG_10944 [Fusarium oxyspor... 57 5e-06 gb|EWG52850.1| hypothetical protein FVEG_11457 [Fusarium vertici... 57 5e-06 >ref|XP_007673027.1| hypothetical protein BAUCODRAFT_30404 [Baudoinia panamericana UAMH 10762] gi|449303970|gb|EMC99977.1| hypothetical protein BAUCODRAFT_30404 [Baudoinia panamericana UAMH 10762] Length = 337 Score = 65.5 bits (158), Expect = 2e-08 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGSKGYWSVYVTGI 365 CG+ LPPA++KVDD++CN+ C GF E+CG +WSVY++GI Sbjct: 95 CGNTLPPANSKVDDSQCNVPCNGFDKENCGGANFWSVYLSGI 136 >ref|XP_014172838.1| wsc domain protein [Grosmannia clavigera kw1407] gi|320590915|gb|EFX03356.1| wsc domain protein [Grosmannia clavigera kw1407] Length = 296 Score = 64.7 bits (156), Expect = 3e-08 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGSKGYWSVYVTGI 365 CGD PP ST VDD+KCN C G+G ++CG GYW+VY TGI Sbjct: 94 CGDSYPPNSTLVDDSKCNTPCTGYGVDACGGVGYWTVYNTGI 135 >gb|KJR83523.1| cell wall integrity and stress response component [Sporothrix schenckii 1099-18] Length = 313 Score = 62.8 bits (151), Expect = 1e-07 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGSKGYWSVYVTGI 365 CGD PP ST VDD CN C GFG ++CG GYW+VY TG+ Sbjct: 89 CGDSYPPNSTLVDDKYCNAPCTGFGQDACGGTGYWTVYNTGL 130 >gb|KIH93908.1| cell wall integrity and stress response component [Sporothrix brasiliensis 5110] Length = 288 Score = 62.8 bits (151), Expect = 1e-07 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGSKGYWSVYVTGI 365 CGD PP ST VDD CN C GFG ++CG GYW+VY TG+ Sbjct: 89 CGDSYPPNSTLVDDKYCNAPCTGFGQDACGGTGYWTVYNTGL 130 >gb|ERS98866.1| hypothetical protein HMPREF1624_04056 [Sporothrix schenckii ATCC 58251] Length = 283 Score = 62.8 bits (151), Expect = 1e-07 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGSKGYWSVYVTGI 365 CGD PP ST VDD CN C GFG ++CG GYW+VY TG+ Sbjct: 89 CGDSYPPNSTLVDDKYCNAPCTGFGQDACGGTGYWTVYNTGL 130 >ref|XP_007294675.1| WSC domain containing protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406861973|gb|EKD15025.1| WSC domain containing protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 286 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 112 FLFIRNRKRKAIEEEYKRNAAVSSFIAGGNPPSSSGG 2 F F+R+RKR+ IEEEYKRNAAV+SFIAGG PP+SS G Sbjct: 210 FFFMRHRKRRDIEEEYKRNAAVNSFIAGGKPPTSSAG 246 Score = 56.2 bits (134), Expect = 9e-06 Identities = 19/42 (45%), Positives = 29/42 (69%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGSKGYWSVYVTGI 365 C + LPP V +KC CPG+ ++CG++G+WSVY+TG+ Sbjct: 72 CSETLPPVEANVAPSKCTTACPGYPDDTCGARGHWSVYLTGL 113 >ref|XP_007931416.1| hypothetical protein MYCFIDRAFT_191065 [Pseudocercospora fijiensis CIRAD86] gi|452977839|gb|EME77603.1| hypothetical protein MYCFIDRAFT_191065 [Pseudocercospora fijiensis CIRAD86] Length = 263 Score = 60.8 bits (146), Expect = 4e-07 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGSKGYWSVYVTG 368 CGD +P S KVDD+KCN CPG+ CG G+WSVY TG Sbjct: 59 CGDNMPSDSDKVDDSKCNTPCPGWDKVECGGDGFWSVYTTG 99 >gb|KJY02024.1| WSC domain containing protein [Zymoseptoria brevis] Length = 289 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGSKGYWSVYVTG 368 CGD LPP + KVDDT CN C GF ++CG G++SVY TG Sbjct: 82 CGDQLPPVADKVDDTSCNQPCVGFPDDTCGGNGFYSVYTTG 122 >ref|XP_008711329.1| hypothetical protein HMPREF1541_00803 [Cyphellophora europaea CBS 101466] gi|568124032|gb|ETN46617.1| hypothetical protein HMPREF1541_00803 [Cyphellophora europaea CBS 101466] Length = 278 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGSKGYWSVYVTGI 365 CGD LPP S KVD KCN C GFG ++CG GY+ Y+TG+ Sbjct: 84 CGDTLPPNSKKVDSDKCNTPCGGFGEKTCGGIGYYQFYLTGL 125 >gb|KIW02854.1| hypothetical protein PV09_05908 [Verruconis gallopava] Length = 292 Score = 59.7 bits (143), Expect = 8e-07 Identities = 21/42 (50%), Positives = 31/42 (73%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGSKGYWSVYVTGI 365 CGD++PP +T+VD++ CN C G +E CG +W+VY+TGI Sbjct: 104 CGDLIPPVTTQVDNSSCNTPCSGIDTEMCGGDNFWTVYLTGI 145 >gb|KKY14700.1| putative wsc domain-containing protein [Diplodia seriata] Length = 288 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/42 (54%), Positives = 29/42 (69%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGSKGYWSVYVTGI 365 CG+VLP TKVDD KCN C G+ ++CG + YW V +TGI Sbjct: 91 CGNVLPAKDTKVDDDKCNTPCNGYPQDNCGGRNYWQVALTGI 132 >gb|ESZ93607.1| hypothetical protein SBOR_6036 [Sclerotinia borealis F-4157] Length = 294 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/42 (61%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESC-GSKGYWSVYVTG 368 CGD LPPA VDD+KCN C G +E C G+K YWSVY+TG Sbjct: 83 CGDDLPPADDLVDDSKCNSPCAGINTEMCGGTKRYWSVYLTG 124 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/37 (62%), Positives = 32/37 (86%) Frame = -2 Query: 112 FLFIRNRKRKAIEEEYKRNAAVSSFIAGGNPPSSSGG 2 F+F+RN+KR+ +EEEY+RNAAV++F+ GG P SSGG Sbjct: 220 FVFMRNKKRREVEEEYRRNAAVNNFVTGGKSPVSSGG 256 >ref|XP_007913692.1| putative wsc domain containing protein [Togninia minima UCRPA7] gi|500258643|gb|EOO01554.1| putative wsc domain containing protein [Phaeoacremonium minimum UCRPA7] Length = 289 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGSKGYWSVYVTGI 365 CGD PP ST VDD KCN C G+ ++CG YW++Y TG+ Sbjct: 95 CGDKYPPESTLVDDKKCNSPCAGYDQQACGGLNYWTIYNTGV 136 >gb|EPQ63644.1| hypothetical protein BGT96224_ASP20468 [Blumeria graminis f. sp. tritici 96224] Length = 270 Score = 58.5 bits (140), Expect = 2e-06 Identities = 22/42 (52%), Positives = 31/42 (73%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGSKGYWSVYVTGI 365 CG LPP ++ VDD KC I CPG+ S+ CG G++S+Y+TG+ Sbjct: 72 CGSKLPPTNSLVDDAKCAIPCPGYPSDVCGGNGFYSLYLTGL 113 >ref|XP_008086007.1| hypothetical protein GLAREA_02731 [Glarea lozoyensis ATCC 20868] gi|512197982|gb|EPE26817.1| hypothetical protein GLAREA_02731 [Glarea lozoyensis ATCC 20868] Length = 284 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/38 (71%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -2 Query: 112 FLFIRNRKRKAIEEEYKRNAAVSSFIA-GGNPPSSSGG 2 F+FIR++KR+ +E+EY+RNAAVSSFIA GG PP SSGG Sbjct: 208 FIFIRSKKRREVEDEYRRNAAVSSFIANGGKPPMSSGG 245 >gb|EHL00872.1| putative Cell wall integrity and stress response component 1 [Glarea lozoyensis 74030] Length = 151 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/38 (71%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -2 Query: 112 FLFIRNRKRKAIEEEYKRNAAVSSFIA-GGNPPSSSGG 2 F+FIR++KR+ +E+EY+RNAAVSSFIA GG PP SSGG Sbjct: 75 FIFIRSKKRREVEDEYRRNAAVSSFIANGGKPPMSSGG 112 >gb|KIV96131.1| hypothetical protein PV10_00035 [Exophiala mesophila] Length = 284 Score = 57.4 bits (137), Expect = 4e-06 Identities = 20/42 (47%), Positives = 29/42 (69%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGSKGYWSVYVTGI 365 CGD +PP +VD + C+ C G+G ++CG GYW VY+TG+ Sbjct: 82 CGDEIPPKDQEVDSSNCDSVCGGYGEQTCGGLGYWQVYLTGL 123 >ref|XP_003848577.1| hypothetical protein MYCGRDRAFT_106153 [Zymoseptoria tritici IPO323] gi|339468452|gb|EGP83553.1| hypothetical protein MYCGRDRAFT_106153 [Zymoseptoria tritici IPO323] Length = 269 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGSKGYWSVYVTG 368 CGD LP + KVDDT CN C GF ++CG G++SVY TG Sbjct: 56 CGDQLPAVADKVDDTSCNQPCVGFPDDTCGGNGFYSVYTTG 96 >gb|EWY86391.1| hypothetical protein FOYG_10944 [Fusarium oxysporum FOSC 3-a] Length = 280 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGS-KGYWSVYVTG 368 CGDV P +VDD KCN CPG+G +CG+ K YWSVY +G Sbjct: 84 CGDVYPKEGDQVDDDKCNWPCPGYGKAACGALKNYWSVYNSG 125 >gb|EWG52850.1| hypothetical protein FVEG_11457 [Fusarium verticillioides 7600] Length = 280 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = -2 Query: 490 CGDVLPPASTKVDDTKCNINCPGFGSESCGS-KGYWSVYVTG 368 CGDV P +VDD KCN CPG+G +CG+ K YWSVY +G Sbjct: 84 CGDVYPKEGDQVDDDKCNWPCPGYGKAACGALKNYWSVYNSG 125