BLASTX nr result
ID: Ophiopogon21_contig00043817
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00043817 (406 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX59530.1| hypothetical protein RirG_188220 [Rhizophagus irr... 60 8e-07 gb|ESA23938.1| hypothetical protein GLOINDRAFT_90687 [Rhizophagu... 60 8e-07 >gb|EXX59530.1| hypothetical protein RirG_188220 [Rhizophagus irregularis DAOM 197198w] Length = 323 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 406 YPQQHIRPSEDTEAPLKPTAQDVLPIYLDGLGRAEFEKK 290 YPQQHI P E+T++ LKPTA DVL +YLDGL RAEFEKK Sbjct: 286 YPQQHILPMENTQS-LKPTADDVLRVYLDGLDRAEFEKK 323 >gb|ESA23938.1| hypothetical protein GLOINDRAFT_90687 [Rhizophagus irregularis DAOM 181602] Length = 343 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 406 YPQQHIRPSEDTEAPLKPTAQDVLPIYLDGLGRAEFEKK 290 YPQQHI P E+T++ LKPTA DVL +YLDGL RAEFEKK Sbjct: 277 YPQQHILPMENTQS-LKPTADDVLRVYLDGLDRAEFEKK 314