BLASTX nr result
ID: Ophiopogon21_contig00043665
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00043665 (526 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CFW93204.1| 30S ribosomal protein S9 [endosymbiont DhMRE of ... 100 7e-19 ref|WP_025014702.1| MULTISPECIES: 30S ribosomal protein S9 [Lact... 69 1e-09 ref|WP_013853524.1| 30S ribosomal protein S9 [Lactobacillus kefi... 69 1e-09 ref|WP_013437153.1| MULTISPECIES: 30S ribosomal protein S9 [Lact... 69 1e-09 ref|WP_046307530.1| 30S ribosomal protein S9 [Lactobacillus apis... 69 2e-09 ref|WP_054681184.1| 30S ribosomal protein S9 [Lactobacillus acet... 69 2e-09 ref|WP_057797272.1| 30S ribosomal protein S9 [Lactobacillus kali... 68 2e-09 ref|WP_034980394.1| MULTISPECIES: 30S ribosomal protein S9 [Lact... 68 2e-09 ref|WP_025080072.1| 30S ribosomal protein S9 [Lactobacillus hams... 68 2e-09 ref|WP_006351901.1| 30S ribosomal protein S9 [Lactobacillus amyl... 68 2e-09 ref|WP_005720370.1| 30S ribosomal protein S9 [Lactobacillus cris... 68 2e-09 ref|WP_013085821.1| 30S ribosomal protein S9 [Lactobacillus cris... 68 3e-09 ref|WP_003549055.1| 30S ribosomal protein S9 [Lactobacillus acid... 68 3e-09 ref|WP_008469881.1| 30S ribosomal protein S9 [Lactobacillus homi... 68 3e-09 ref|WP_005724173.1| 30S ribosomal protein S9 [Lactobacillus cris... 68 3e-09 ref|WP_007126822.1| 30S ribosomal protein S9 [Lactobacillus ultu... 68 3e-09 ref|WP_006729442.1| MULTISPECIES: 30S ribosomal protein S9 [Lact... 67 4e-09 emb|CDE16340.1| 30S ribosomal protein S9 [Clostridium sp. CAG:288] 67 4e-09 ref|YP_063584.1| ribosomal protein S9 [Gracilaria tenuistipitata... 67 5e-09 ref|WP_004895822.1| 30S ribosomal protein S9 [Lactobacillus john... 67 5e-09 >emb|CFW93204.1| 30S ribosomal protein S9 [endosymbiont DhMRE of Dentiscutata heterogama] Length = 135 Score = 99.8 bits (247), Expect = 7e-19 Identities = 47/67 (70%), Positives = 55/67 (82%) Frame = -2 Query: 201 LEDYFYMEPSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPD 22 L DYFYMEPSLC+DI +PLKLF K+ D+D RV+GSG SQAGAIRL +ARALLK+ P+ Sbjct: 39 LHDYFYMEPSLCEDILRPLKLFNKENDFDFFARVKGSGPQSQAGAIRLALARALLKVSPE 98 Query: 21 YKNTLKN 1 YK TLKN Sbjct: 99 YKITLKN 105 >ref|WP_025014702.1| MULTISPECIES: 30S ribosomal protein S9 [Lactobacillus] gi|948608752|gb|KRK41128.1| 30S ribosomal protein S9 [Lactobacillus amylovorus DSM 20531] gi|948781720|gb|KRM04121.1| 30S ribosomal protein S9 [Lactobacillus kitasatonis DSM 16761 = JCM 1039] Length = 131 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/64 (54%), Positives = 43/64 (67%) Frame = -2 Query: 195 DYFYMEPSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYK 16 D + P+L KD+ QPL L D YD+ V V G GF QAGAIRLGVARALL++ PD++ Sbjct: 37 DQYIPFPNLVKDLKQPLTLTETDGQYDVHVNVNGGGFSGQAGAIRLGVARALLEVDPDFR 96 Query: 15 NTLK 4 LK Sbjct: 97 GPLK 100 >ref|WP_013853524.1| 30S ribosomal protein S9 [Lactobacillus kefiranofaciens] gi|333956914|gb|AEG39722.1| 30S ribosomal protein S9 [Lactobacillus kefiranofaciens ZW3] gi|948702639|gb|KRL30342.1| 30S ribosomal protein S9 [Lactobacillus kefiranofaciens subsp. kefirgranum DSM 10550 = JCM 8572] gi|948801944|gb|KRM22894.1| 30S ribosomal protein S9 [Lactobacillus kefiranofaciens subsp. kefiranofaciens DSM 5016 = JCM 6985] Length = 131 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/64 (54%), Positives = 43/64 (67%) Frame = -2 Query: 195 DYFYMEPSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYK 16 D + P+L KD+ QPL L D YD+ V V G GF QAGAIRLGVARALL++ PD++ Sbjct: 37 DQYIPFPNLVKDLKQPLTLTETDGQYDVHVNVNGGGFSGQAGAIRLGVARALLEVDPDFR 96 Query: 15 NTLK 4 LK Sbjct: 97 GPLK 100 >ref|WP_013437153.1| MULTISPECIES: 30S ribosomal protein S9 [Lactobacillus] gi|312275697|gb|ADQ58337.1| 30S ribosomal protein S9 [Lactobacillus amylovorus GRL 1112] gi|325332602|gb|ADZ06510.1| 30S ribosomal protein S9 [Lactobacillus amylovorus] gi|327182860|gb|AEA31307.1| 30S ribosomal protein S9 [Lactobacillus amylovorus GRL1118] gi|524264145|emb|CDA27061.1| 30S ribosomal protein S9 [Lactobacillus amylovorus CAG:719] gi|948980673|gb|KRN92572.1| 30S ribosomal protein S9 [Lactobacillus amylovorus DSM 16698] Length = 131 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/64 (54%), Positives = 43/64 (67%) Frame = -2 Query: 195 DYFYMEPSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYK 16 D + P+L KD+ QPL L D YD+ V V G GF QAGAIRLGVARALL++ PD++ Sbjct: 37 DQYIPFPNLVKDLKQPLTLTETDGQYDVHVNVNGGGFSGQAGAIRLGVARALLEVDPDFR 96 Query: 15 NTLK 4 LK Sbjct: 97 GPLK 100 >ref|WP_046307530.1| 30S ribosomal protein S9 [Lactobacillus apis] gi|797156272|gb|KJY60142.1| 30S ribosomal protein S9 [Lactobacillus apis] Length = 131 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/64 (53%), Positives = 43/64 (67%) Frame = -2 Query: 195 DYFYMEPSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYK 16 D + P+L KD+ QPL L D YD+ V V G GF QAGAIRLG+ARALL + PD++ Sbjct: 37 DEYIPFPNLVKDLKQPLTLTETDNQYDVKVNVSGGGFSGQAGAIRLGIARALLGVDPDFR 96 Query: 15 NTLK 4 + LK Sbjct: 97 SPLK 100 >ref|WP_054681184.1| 30S ribosomal protein S9 [Lactobacillus acetotolerans] gi|766541816|dbj|BAQ56777.1| 30S ribosomal protein S9 [Lactobacillus acetotolerans] gi|948928219|gb|KRN42167.1| 30S ribosomal protein S9 [Lactobacillus acetotolerans DSM 20749 = JCM 3825] Length = 131 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/58 (58%), Positives = 41/58 (70%) Frame = -2 Query: 177 PSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYKNTLK 4 P+L KD+ QPL L D YD+ V V G GF QAGAIRLGVARALL++ PD++ LK Sbjct: 43 PNLVKDLKQPLTLTETDGQYDVKVNVNGGGFSGQAGAIRLGVARALLEVDPDFRGPLK 100 >ref|WP_057797272.1| 30S ribosomal protein S9 [Lactobacillus kalixensis] gi|948768099|gb|KRL91177.1| 30S ribosomal protein S9 [Lactobacillus kalixensis DSM 16043] Length = 131 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/64 (53%), Positives = 42/64 (65%) Frame = -2 Query: 195 DYFYMEPSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYK 16 D + P+L KD+ QPL L D YD+ V V G GF QAGAIRLG+ARALL + PD++ Sbjct: 37 DVYIPFPNLVKDLKQPLTLTETDGQYDVRVNVNGGGFSGQAGAIRLGIARALLDVDPDFR 96 Query: 15 NTLK 4 LK Sbjct: 97 GPLK 100 >ref|WP_034980394.1| MULTISPECIES: 30S ribosomal protein S9 [Lactobacillus] gi|692179928|gb|KGG53876.1| SSU ribosomal protein S9p (S16e) [Lactobacillus sp. wkB10] gi|692333428|gb|AIS09628.1| SSU ribosomal protein S9p (S16e) [Lactobacillus sp. wkB8] gi|797150577|gb|KJY54642.1| 30S ribosomal protein S9 [Lactobacillus kullabergensis] gi|797152282|gb|KJY56303.1| 30S ribosomal protein S9 [Lactobacillus melliventris] gi|797153671|gb|KJY57667.1| 30S ribosomal protein S9 [Lactobacillus kimbladii] gi|797159652|gb|KJY63431.1| 30S ribosomal protein S9 [Lactobacillus helsingborgensis] Length = 131 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/64 (51%), Positives = 43/64 (67%) Frame = -2 Query: 195 DYFYMEPSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYK 16 D + P+L KD+ QPL L + YD+ V V G GF QAGAIRLG+ARALL++ PD++ Sbjct: 37 DQYIPFPNLVKDLKQPLTLTETENQYDVKVNVNGGGFSGQAGAIRLGIARALLEVDPDFR 96 Query: 15 NTLK 4 LK Sbjct: 97 GPLK 100 >ref|WP_025080072.1| 30S ribosomal protein S9 [Lactobacillus hamsteri] gi|948821467|gb|KRM40966.1| 30S ribosomal protein S9 [Lactobacillus hamsteri DSM 5661 = JCM 6256] Length = 131 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = -2 Query: 177 PSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYKNTLK 4 P+L KD+ QPL L D YD+ V V G GF QAGAIRLG+ARALL + PD+++ LK Sbjct: 43 PNLVKDLKQPLTLTETDGQYDIHVNVNGGGFSGQAGAIRLGIARALLDVDPDFRSPLK 100 >ref|WP_006351901.1| 30S ribosomal protein S9 [Lactobacillus amylolyticus] gi|295064636|gb|EFG55557.1| ribosomal protein S9 [Lactobacillus amylolyticus DSM 11664] gi|948691422|gb|KRL19869.1| 30S ribosomal protein S9 [Lactobacillus amylolyticus DSM 11664] Length = 131 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/58 (56%), Positives = 41/58 (70%) Frame = -2 Query: 177 PSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYKNTLK 4 P+L KD+ QPL L D YD+ V V G GF QAGAIRLG+ARALL + PD+++ LK Sbjct: 43 PNLVKDLKQPLTLTETDGQYDIHVNVNGGGFSGQAGAIRLGIARALLDVDPDFRSPLK 100 >ref|WP_005720370.1| 30S ribosomal protein S9 [Lactobacillus crispatus] gi|227861169|gb|EEJ68818.1| ribosomal protein S9 [Lactobacillus crispatus JV-V01] gi|256713926|gb|EEU28914.1| 30S ribosomal protein S9 [Lactobacillus crispatus MV-1A-US] gi|260572411|gb|EEX28973.1| ribosomal protein S9 [Lactobacillus crispatus MV-3A-US] gi|290923092|gb|EFE00024.1| ribosomal protein S9 [Lactobacillus crispatus 214-1] gi|310895297|gb|EFQ44365.1| ribosomal protein S9 [Lactobacillus crispatus CTV-05] gi|405587882|gb|EKB61603.1| 30S ribosomal protein S9 [Lactobacillus crispatus FB049-03] gi|405606039|gb|EKB79036.1| 30S ribosomal protein S9 [Lactobacillus crispatus FB077-07] gi|675156490|gb|KFL93292.1| ribosomal protein S9 [Lactobacillus crispatus SJ-3C-US] gi|899149864|emb|CPR93646.1| 30S ribosomal protein S9 [Chlamydia trachomatis] Length = 131 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/64 (51%), Positives = 44/64 (68%) Frame = -2 Query: 195 DYFYMEPSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYK 16 D + P+L KD+ QPL L + YD+ V V G GF QAGAIRLG+ARALL++ PD++ Sbjct: 37 DQYIPFPNLVKDLKQPLTLTETEGQYDIHVNVNGGGFSGQAGAIRLGIARALLEVDPDFR 96 Query: 15 NTLK 4 + LK Sbjct: 97 SPLK 100 >ref|WP_013085821.1| 30S ribosomal protein S9 [Lactobacillus crispatus] gi|295030298|emb|CBL49777.1| 30S ribosomal protein S9 [Lactobacillus crispatus ST1] Length = 131 Score = 67.8 bits (164), Expect = 3e-09 Identities = 33/64 (51%), Positives = 43/64 (67%) Frame = -2 Query: 195 DYFYMEPSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYK 16 D + P+L KD+ QPL L + YD+ V V G GF QAGAIRLG+ARALL++ PD++ Sbjct: 37 DQYIPFPNLVKDLKQPLTLTETEGQYDIHVNVNGGGFSGQAGAIRLGIARALLEVDPDFR 96 Query: 15 NTLK 4 LK Sbjct: 97 GPLK 100 >ref|WP_003549055.1| 30S ribosomal protein S9 [Lactobacillus acidophilus] gi|58336662|ref|YP_193247.1| 30S ribosomal protein S9 [Lactobacillus acidophilus NCFM] gi|58253979|gb|AAV42216.1| 30S ribosomal protein S9 [Lactobacillus acidophilus NCFM] gi|227869025|gb|EEJ76446.1| ribosomal protein S9 [Lactobacillus acidophilus ATCC 4796] gi|488446300|gb|AGK93543.1| SSU ribosomal protein S9p (S16e) [Lactobacillus acidophilus La-14] gi|523545450|emb|CDF74370.1| 30S ribosomal protein S9 [Lactobacillus acidophilus DSM 9126] gi|523549217|emb|CDF68800.1| 30S ribosomal protein S9 [Lactobacillus acidophilus CIRM-BIA 442] gi|523549591|emb|CDF76383.1| 30S ribosomal protein S9 [Lactobacillus acidophilus DSM 20242] gi|523553417|emb|CDF70558.1| 30S ribosomal protein S9 [Lactobacillus acidophilus CIRM-BIA 445] gi|523554899|emb|CDF67116.1| 30S ribosomal protein S9 [Lactobacillus acidophilus CIP 76.13] gi|725541309|gb|KHE30742.1| 30S ribosomal protein S9 [Lactobacillus acidophilus] gi|761525466|gb|AJP45786.1| 30S ribosomal protein S9 [Lactobacillus acidophilus] gi|948595923|gb|KRK28850.1| 30S ribosomal protein S9 [Lactobacillus acidophilus DSM 20079 = JCM 1132 = NBRC 13951] Length = 131 Score = 67.8 bits (164), Expect = 3e-09 Identities = 33/64 (51%), Positives = 43/64 (67%) Frame = -2 Query: 195 DYFYMEPSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYK 16 D + P+L KD+ QPL L + YD+ V V G GF QAGAIRLG+ARALL++ PD++ Sbjct: 37 DQYIPFPNLVKDLKQPLTLTETEGQYDIHVNVNGGGFSGQAGAIRLGIARALLEVDPDFR 96 Query: 15 NTLK 4 LK Sbjct: 97 GPLK 100 >ref|WP_008469881.1| 30S ribosomal protein S9 [Lactobacillus hominis] gi|394484450|emb|CCI81215.1| 30S ribosomal protein S9 [Lactobacillus hominis DSM 23910 = CRBIP 24.179] gi|948869118|gb|KRM85368.1| 30S ribosomal protein S9 [Lactobacillus hominis DSM 23910 = CRBIP 24.179] Length = 131 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/58 (53%), Positives = 43/58 (74%) Frame = -2 Query: 177 PSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYKNTLK 4 P+L +D+ QPL L + YD++V V G GF QAGAIRLG+ARALL++ PD+++ LK Sbjct: 43 PNLVQDLKQPLALTETEGQYDILVNVNGGGFSGQAGAIRLGIARALLEVDPDFRSPLK 100 >ref|WP_005724173.1| 30S ribosomal protein S9 [Lactobacillus crispatus] gi|256613540|gb|EEU18743.1| ribosomal protein S9 [Lactobacillus crispatus 125-2-CHN] gi|557948864|gb|EST03362.1| 30S ribosomal protein S9 [Lactobacillus crispatus EM-LC1] gi|948603214|gb|KRK35828.1| 30S ribosomal protein S9 [Lactobacillus crispatus DSM 20584 = JCM 1185] Length = 131 Score = 67.8 bits (164), Expect = 3e-09 Identities = 33/64 (51%), Positives = 43/64 (67%) Frame = -2 Query: 195 DYFYMEPSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYK 16 D + P+L KD+ QPL L + YD+ V V G GF QAGAIRLG+ARALL++ PD++ Sbjct: 37 DQYIPFPNLVKDLKQPLTLTETEGQYDIHVNVNGGGFSGQAGAIRLGIARALLEVDPDFR 96 Query: 15 NTLK 4 LK Sbjct: 97 GPLK 100 >ref|WP_007126822.1| 30S ribosomal protein S9 [Lactobacillus ultunensis] gi|227863712|gb|EEJ71133.1| ribosomal protein S9 [Lactobacillus ultunensis DSM 16047] gi|948759175|gb|KRL82749.1| 30S ribosomal protein S9 [Lactobacillus ultunensis DSM 16047] Length = 131 Score = 67.8 bits (164), Expect = 3e-09 Identities = 34/64 (53%), Positives = 43/64 (67%) Frame = -2 Query: 195 DYFYMEPSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYK 16 D + P+L KD+ QPL L + YD+ V V G GF QAGAIRLGVARALL++ PD++ Sbjct: 37 DQYIPFPNLVKDLKQPLTLTETEGQYDVHVNVNGGGFSGQAGAIRLGVARALLEVDPDFR 96 Query: 15 NTLK 4 LK Sbjct: 97 GPLK 100 >ref|WP_006729442.1| MULTISPECIES: 30S ribosomal protein S9 [Lactobacillus] gi|259167619|gb|EEW52114.1| ribosomal protein S9 [Lactobacillus iners DSM 13335] gi|308164256|gb|EFO66513.1| ribosomal protein S9 [Lactobacillus iners LactinV 11V1-d] gi|308165719|gb|EFO67944.1| ribosomal protein S9 [Lactobacillus iners LactinV 09V1-c] gi|308166872|gb|EFO69056.1| ribosomal protein S9 [Lactobacillus iners LactinV 03V1-b] gi|308168346|gb|EFO70465.1| ribosomal protein S9 [Lactobacillus iners LactinV 01V1-a] gi|308170534|gb|EFO72554.1| ribosomal protein S9 [Lactobacillus iners SPIN 2503V10-D] gi|311089588|gb|EFQ48013.1| ribosomal protein S9 [Lactobacillus iners LEAF 2053A-b] gi|311090431|gb|EFQ48840.1| ribosomal protein S9 [Lactobacillus iners LEAF 2052A-d] gi|311091742|gb|EFQ50121.1| ribosomal protein S9 [Lactobacillus iners LEAF 2062A-h1] gi|311093166|gb|EFQ51512.1| ribosomal protein S9 [Lactobacillus iners LEAF 3008A-a] gi|315488689|gb|EFU78335.1| ribosomal protein S9 [Lactobacillus iners ATCC 55195] gi|325475847|gb|EGC79017.1| ribosomal protein S9 [Lactobacillus iners UPII 143-D] gi|325477481|gb|EGC80624.1| ribosomal protein S9 [Lactobacillus iners UPII 60-B] gi|328935894|gb|EGG32354.1| ribosomal protein S9 [Lactobacillus iners SPIN 1401G] gi|348608360|gb|EGY58345.1| 30S ribosomal protein S9 [Lactobacillus sp. 7_1_47FAA] gi|948734986|gb|KRL60349.1| 30S ribosomal protein S9 [Lactobacillus iners DSM 13335] Length = 131 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = -2 Query: 177 PSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYKNTLK 4 P+L KD+ QPL L + YD+IV V G GF QAGAIR G+ARALL++ PD++ +LK Sbjct: 43 PNLVKDLKQPLALTETEGQYDVIVNVNGGGFSGQAGAIRHGIARALLEVDPDFRGSLK 100 >emb|CDE16340.1| 30S ribosomal protein S9 [Clostridium sp. CAG:288] Length = 137 Score = 67.4 bits (163), Expect = 4e-09 Identities = 38/103 (36%), Positives = 54/103 (52%) Frame = -2 Query: 312 KTRKTLSVVKFETEEKLIELKKQFRQEKEDPYKR*PRLEDYFYMEPSLCKDIYQPLKLFG 133 K K V + T + + + + Q E R D F+ +L D+ QPL L G Sbjct: 4 KKSKNAEVKYYGTGRRKSSVARVYLQAGEGKITVNGRDADEFFPHDTLVIDVKQPLSLTG 63 Query: 132 KDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYKNTLK 4 +D+I V G G+ QAGA+RLG+ RALL++ PDY+ TLK Sbjct: 64 NIDKFDVIAFVNGGGYTGQAGALRLGITRALLQVSPDYRKTLK 106 >ref|YP_063584.1| ribosomal protein S9 [Gracilaria tenuistipitata var. liui] gi|68052939|sp|Q6B8X6.1|RR9_GRATL RecName: Full=30S ribosomal protein S9, chloroplastic (chloroplast) [Gracilaria tenuistipitata var. liui] gi|50657674|gb|AAT79659.1| 30S ribosomal protein S9 [Gracilaria tenuistipitata var. liui] Length = 137 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/65 (47%), Positives = 42/65 (64%) Frame = -2 Query: 198 EDYFYMEPSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDY 19 E Y P+ + Y PLK+ G +K+YD+ V+ EG G QA AIRLG+ARAL ++ PD Sbjct: 42 ESYLQFSPNYLRVSYSPLKILGLNKEYDIYVKTEGGGLTGQANAIRLGLARALCRMNPDN 101 Query: 18 KNTLK 4 + TLK Sbjct: 102 RTTLK 106 >ref|WP_004895822.1| 30S ribosomal protein S9 [Lactobacillus johnsonii] gi|41582747|gb|AAS08358.1| 30S ribosomal protein S9 [Lactobacillus johnsonii NCC 533] gi|227850656|gb|EEJ60742.1| ribosomal protein S9 [Lactobacillus johnsonii ATCC 33200] gi|262397259|emb|CAX66273.1| ribosomal protein S9 [Lactobacillus johnsonii FI9785] gi|329666725|gb|AEB92673.1| 30S ribosomal protein S9 [Lactobacillus johnsonii DPC 6026] gi|559161512|gb|AHA96825.1| 30S ribosomal protein S9 [Lactobacillus johnsonii N6.2] gi|918785638|gb|KOH02504.1| 30S ribosomal protein S9 [Lactobacillus johnsonii 16] gi|948623145|gb|KRK54963.1| 30S ribosomal protein S9 [Lactobacillus johnsonii ATCC 33200] Length = 131 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/58 (53%), Positives = 42/58 (72%) Frame = -2 Query: 177 PSLCKDIYQPLKLFGKDKDYDLIVRVEGSGFHSQAGAIRLGVARALLKIFPDYKNTLK 4 P+L +D+ QPL L + YD++V V G GF QAGAIRLG+ARALL++ PD++ LK Sbjct: 43 PNLVQDMKQPLALTETEGQYDILVNVNGGGFSGQAGAIRLGIARALLEVDPDFRGPLK 100