BLASTX nr result
ID: Ophiopogon21_contig00043474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00043474 (531 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_046876397.1| hypothetical protein, partial [Vibrio paraha... 57 5e-06 >ref|WP_046876397.1| hypothetical protein, partial [Vibrio parahaemolyticus] gi|821242584|gb|KKZ05227.1| hypothetical protein YC68_24375, partial [Vibrio parahaemolyticus] Length = 66 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/65 (46%), Positives = 40/65 (61%) Frame = -3 Query: 307 MDRSVLLLVKDDAVMINRGTRGQPYSGARGEIL*PSEDDLMRKQLARVLSLIKHEGWGSK 128 +D ++L VMINR +RG Y RGEIL +D+ +RK L R+ SLIK+E WG + Sbjct: 1 LDSDPIVLAFGIGVMINRDSRGHSYFIVRGEILGFMKDEQLRKHLPRMFSLIKNESWGLE 60 Query: 127 DD*TP 113 DD P Sbjct: 61 DDQIP 65