BLASTX nr result
ID: Ophiopogon21_contig00043464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00043464 (443 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIW04964.1| hypothetical protein PV09_04127 [Verruconis gallo... 57 4e-06 >gb|KIW04964.1| hypothetical protein PV09_04127 [Verruconis gallopava] Length = 394 Score = 57.4 bits (137), Expect = 4e-06 Identities = 33/61 (54%), Positives = 39/61 (63%), Gaps = 4/61 (6%) Frame = -3 Query: 423 VRRSQDMRSPFDDPSE---DDAISEISTVRETPRRQGDQLSVVSDLSYQEE-EPVVGHSA 256 VRRS ++RSPFDDP E D+ SE ST+R R D+LS SDLSYQE+ P HS Sbjct: 334 VRRSNEVRSPFDDPEEAEEDEHASEASTLRGGARMSTDRLSEASDLSYQEDPRPTASHSH 393 Query: 255 V 253 V Sbjct: 394 V 394