BLASTX nr result
ID: Ophiopogon21_contig00043386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00043386 (463 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007288368.1| 60S ribosomal protein L36 [Marssonina brunne... 117 3e-24 gb|EWC46294.1| 60S ribosomal protein L36 [Drechslerella stenobro... 113 5e-23 emb|CCU78895.1| 60S ribosomal protein L36 [Blumeria graminis f. ... 113 6e-23 gb|EPQ67472.1| N-terminally acetylated protein component of the ... 113 6e-23 ref|XP_008076887.1| 60S ribosomal protein L36 (TRP36) [Glarea lo... 112 8e-23 gb|KOM23366.1| hypothetical protein XA68_4442 [Ophiocordyceps un... 112 1e-22 gb|KIN03986.1| hypothetical protein OIDMADRAFT_118376 [Oidiodend... 112 1e-22 gb|ESZ95354.1| 60S ribosomal protein L36 [Sclerotinia borealis F... 112 1e-22 ref|XP_009259005.1| hypothetical protein FPSE_07612 [Fusarium ps... 111 2e-22 ref|XP_007589793.1| ribosomal protein L36e [Colletotrichum fiori... 110 3e-22 ref|XP_001229102.1| 60S ribosomal protein L36 [Chaetomium globos... 110 3e-22 gb|EME39696.1| hypothetical protein DOTSEDRAFT_75371 [Dothistrom... 110 3e-22 ref|XP_001586348.1| 60S ribosomal protein L36 [Sclerotinia scler... 110 3e-22 ref|XP_001553576.1| 60S ribosomal protein L36 [Botrytis cinerea ... 110 3e-22 ref|XP_001794331.1| hypothetical protein SNOG_03785 [Parastagono... 110 3e-22 gb|KEQ85116.1| ribosomal protein L36e [Aureobasidium pullulans E... 110 4e-22 ref|XP_011108925.1| hypothetical protein H072_2940 [Dactylellina... 110 4e-22 gb|KJZ73511.1| 60S ribosomal protein L36 [Hirsutella minnesotens... 110 5e-22 gb|KIL94551.1| 60s ribosomal protein l36 [Fusarium avenaceum] 110 5e-22 ref|XP_013341821.1| hypothetical protein AUEXF2481DRAFT_42094 [A... 110 5e-22 >ref|XP_007288368.1| 60S ribosomal protein L36 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406868329|gb|EKD21366.1| 60S ribosomal protein L36 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 108 Score = 117 bits (294), Expect = 3e-24 Identities = 65/81 (80%), Positives = 68/81 (83%), Gaps = 2/81 (2%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKD--XXXXXXXXXXLGTFG 290 PRISRSKGK +KRTQFVR+IV+EVSGLAPYERRVIELLRNSKD LGTFG Sbjct: 28 PRISRSKGKMTKRTQFVRDIVKEVSGLAPYERRVIELLRNSKDKRARKLAKKRACLGTFG 87 Query: 289 RAKAKVEELTNVIAESRRAGH 227 RAKAKVEELTNVIAESRRAGH Sbjct: 88 RAKAKVEELTNVIAESRRAGH 108 >gb|EWC46294.1| 60S ribosomal protein L36 [Drechslerella stenobrocha 248] Length = 103 Score = 113 bits (283), Expect = 5e-23 Identities = 59/79 (74%), Positives = 66/79 (83%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PRISR+KGK+SKRT FVREIV+EV+GLAPYE+RVIEL+RNSKD LGTFGRA Sbjct: 25 PRISRTKGKSSKRTLFVREIVKEVAGLAPYEKRVIELIRNSKDKRARKLAKKRLGTFGRA 84 Query: 283 KAKVEELTNVIAESRRAGH 227 K KV+ELT VIAESRRAGH Sbjct: 85 KRKVDELTRVIAESRRAGH 103 >emb|CCU78895.1| 60S ribosomal protein L36 [Blumeria graminis f. sp. hordei DH14] Length = 106 Score = 113 bits (282), Expect = 6e-23 Identities = 60/79 (75%), Positives = 64/79 (81%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PR+SR+KG SKRT FVREIV+EVSGLAPYERRVIELLRNSKD LGTFGRA Sbjct: 28 PRVSRTKGHLSKRTAFVREIVKEVSGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRA 87 Query: 283 KAKVEELTNVIAESRRAGH 227 KAKV+EL VIAESRRAGH Sbjct: 88 KAKVDELQRVIAESRRAGH 106 >gb|EPQ67472.1| N-terminally acetylated protein component of the 60S ribosomal subunit [Blumeria graminis f. sp. tritici 96224] Length = 106 Score = 113 bits (282), Expect = 6e-23 Identities = 60/79 (75%), Positives = 64/79 (81%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PR+SR+KG SKRT FVREIV+EVSGLAPYERRVIELLRNSKD LGTFGRA Sbjct: 28 PRVSRTKGHLSKRTAFVREIVKEVSGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRA 87 Query: 283 KAKVEELTNVIAESRRAGH 227 KAKV+EL VIAESRRAGH Sbjct: 88 KAKVDELQRVIAESRRAGH 106 >ref|XP_008076887.1| 60S ribosomal protein L36 (TRP36) [Glarea lozoyensis ATCC 20868] gi|361126078|gb|EHK98094.1| putative 60S ribosomal protein L36 [Glarea lozoyensis 74030] gi|512207251|gb|EPE36069.1| 60S ribosomal protein L36 (TRP36) [Glarea lozoyensis ATCC 20868] Length = 105 Score = 112 bits (281), Expect = 8e-23 Identities = 59/79 (74%), Positives = 64/79 (81%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PR+SR+KG SKRT FVREIV+EVSGLAPYERRV+ELLRNSKD LGTFGRA Sbjct: 27 PRVSRTKGHLSKRTAFVREIVKEVSGLAPYERRVVELLRNSKDKRARKLAKKRLGTFGRA 86 Query: 283 KAKVEELTNVIAESRRAGH 227 KAKV+EL VIAESRRAGH Sbjct: 87 KAKVDELQRVIAESRRAGH 105 >gb|KOM23366.1| hypothetical protein XA68_4442 [Ophiocordyceps unilateralis] Length = 106 Score = 112 bits (279), Expect = 1e-22 Identities = 58/79 (73%), Positives = 64/79 (81%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PR+SR+KG SKRT FVRE+V+EV+GLAPYERRVIELLRNSKD LGTFGRA Sbjct: 28 PRVSRTKGHLSKRTAFVREVVKEVAGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRA 87 Query: 283 KAKVEELTNVIAESRRAGH 227 K KV+ELT VIAESRRAGH Sbjct: 88 KKKVDELTRVIAESRRAGH 106 >gb|KIN03986.1| hypothetical protein OIDMADRAFT_118376 [Oidiodendron maius Zn] Length = 106 Score = 112 bits (279), Expect = 1e-22 Identities = 59/79 (74%), Positives = 64/79 (81%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PR+SR+KG SKRT FVREIV+EVSGLAPYERRVIELLRNSKD LGTFGRA Sbjct: 28 PRVSRTKGHLSKRTAFVREIVKEVSGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRA 87 Query: 283 KAKVEELTNVIAESRRAGH 227 K+KV+EL VIAESRRAGH Sbjct: 88 KSKVDELQRVIAESRRAGH 106 >gb|ESZ95354.1| 60S ribosomal protein L36 [Sclerotinia borealis F-4157] Length = 106 Score = 112 bits (279), Expect = 1e-22 Identities = 59/79 (74%), Positives = 64/79 (81%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PR+SR+KG SKRT FVR+IV+EVSGLAPYERRVIELLRNSKD LGTFGRA Sbjct: 28 PRVSRTKGHLSKRTAFVRDIVKEVSGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRA 87 Query: 283 KAKVEELTNVIAESRRAGH 227 KAKV+EL VIAESRRAGH Sbjct: 88 KAKVDELQGVIAESRRAGH 106 >ref|XP_009259005.1| hypothetical protein FPSE_07612 [Fusarium pseudograminearum CS3096] gi|758189266|ref|XP_011317013.1| hypothetical protein FGSG_01238 [Fusarium graminearum PH-1] gi|408392930|gb|EKJ72216.1| hypothetical protein FPSE_07612 [Fusarium pseudograminearum CS3096] gi|558856445|gb|ESU06528.1| hypothetical protein FGSG_01238 [Fusarium graminearum PH-1] gi|596544151|gb|EYB24357.1| hypothetical protein FG05_01238 [Fusarium graminearum] gi|699042346|emb|CEF73333.1| unnamed protein product [Fusarium graminearum] gi|927757265|gb|KPA40556.1| 60s ribosomal protein l36 [Fusarium langsethiae] Length = 106 Score = 111 bits (278), Expect = 2e-22 Identities = 58/79 (73%), Positives = 64/79 (81%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PR+SR+KG SKRT FVRE+V+EV+GLAPYERRVIELLRNSKD LGTFGRA Sbjct: 28 PRVSRTKGHLSKRTAFVREVVKEVAGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRA 87 Query: 283 KAKVEELTNVIAESRRAGH 227 KAKV+EL VIAESRRAGH Sbjct: 88 KAKVDELQRVIAESRRAGH 106 >ref|XP_007589793.1| ribosomal protein L36e [Colletotrichum fioriniae PJ7] gi|588907125|gb|EXF86536.1| ribosomal protein L36e [Colletotrichum fioriniae PJ7] Length = 106 Score = 110 bits (276), Expect = 3e-22 Identities = 57/79 (72%), Positives = 63/79 (79%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PR+SR+KG SKRT FVR++V+EVSGLAPYERRVIELLRNSKD LGTFGRA Sbjct: 28 PRVSRTKGHLSKRTAFVRDVVKEVSGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRA 87 Query: 283 KAKVEELTNVIAESRRAGH 227 K KVEE+T VIAESRR GH Sbjct: 88 KRKVEEMTRVIAESRRVGH 106 >ref|XP_001229102.1| 60S ribosomal protein L36 [Chaetomium globosum CBS 148.51] gi|88183183|gb|EAQ90651.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51] Length = 108 Score = 110 bits (276), Expect = 3e-22 Identities = 56/79 (70%), Positives = 64/79 (81%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PR+SR+KG SKRT FVRE+V+EV+GLAPYERR+IELLRNSKD LGTFGRA Sbjct: 30 PRVSRTKGHLSKRTSFVRELVKEVAGLAPYERRIIELLRNSKDKRARKLAKKKLGTFGRA 89 Query: 283 KAKVEELTNVIAESRRAGH 227 KAKVE++ VIAESRRAGH Sbjct: 90 KAKVEDMNRVIAESRRAGH 108 >gb|EME39696.1| hypothetical protein DOTSEDRAFT_75371 [Dothistroma septosporum NZE10] Length = 106 Score = 110 bits (276), Expect = 3e-22 Identities = 58/79 (73%), Positives = 63/79 (79%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PRISR KG SKRT FVR++V+EVSGLAPYERRVIELLRNSKD LGTFGRA Sbjct: 28 PRISRMKGHLSKRTAFVRDVVKEVSGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRA 87 Query: 283 KAKVEELTNVIAESRRAGH 227 K KV+E+T VIAESRRAGH Sbjct: 88 KRKVDEMTKVIAESRRAGH 106 >ref|XP_001586348.1| 60S ribosomal protein L36 [Sclerotinia sclerotiorum 1980 UF-70] gi|154698331|gb|EDN98069.1| 60S ribosomal protein L36 [Sclerotinia sclerotiorum 1980 UF-70] Length = 106 Score = 110 bits (276), Expect = 3e-22 Identities = 58/79 (73%), Positives = 64/79 (81%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 P++SR+KG SKRT FVR+IV+EVSGLAPYERRVIELLRNSKD LGTFGRA Sbjct: 28 PKVSRTKGHLSKRTAFVRDIVKEVSGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRA 87 Query: 283 KAKVEELTNVIAESRRAGH 227 KAKV+EL VIAESRRAGH Sbjct: 88 KAKVDELQGVIAESRRAGH 106 >ref|XP_001553576.1| 60S ribosomal protein L36 [Botrytis cinerea B05.10] gi|347826595|emb|CCD42292.1| similar to 60S ribosomal protein L36 [Botrytis cinerea T4] gi|472242770|gb|EMR87451.1| putative 60s ribosomal protein l36 protein [Botrytis cinerea BcDW1] Length = 106 Score = 110 bits (276), Expect = 3e-22 Identities = 58/79 (73%), Positives = 64/79 (81%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 P++SR+KG SKRT FVR+IV+EVSGLAPYERRVIELLRNSKD LGTFGRA Sbjct: 28 PKVSRTKGHLSKRTAFVRDIVKEVSGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRA 87 Query: 283 KAKVEELTNVIAESRRAGH 227 KAKV+EL VIAESRRAGH Sbjct: 88 KAKVDELQGVIAESRRAGH 106 >ref|XP_001794331.1| hypothetical protein SNOG_03785 [Parastagonospora nodorum SN15] gi|111067870|gb|EAT88990.1| hypothetical protein SNOG_03785 [Parastagonospora nodorum SN15] Length = 106 Score = 110 bits (276), Expect = 3e-22 Identities = 59/79 (74%), Positives = 62/79 (78%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PRISR KG SKRT FVREI EV+GLAPYE+RVIELLRNSKD LGTFGRA Sbjct: 28 PRISRRKGFLSKRTAFVREITREVAGLAPYEKRVIELLRNSKDKRARRLAKKRLGTFGRA 87 Query: 283 KAKVEELTNVIAESRRAGH 227 K KVEE+TNVIAESRRAGH Sbjct: 88 KRKVEEMTNVIAESRRAGH 106 >gb|KEQ85116.1| ribosomal protein L36e [Aureobasidium pullulans EXF-150] Length = 106 Score = 110 bits (275), Expect = 4e-22 Identities = 56/79 (70%), Positives = 64/79 (81%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PR+SR+KG SKRT FVR+IV+EV+GLAPYERRV+ELLRNSKD LGTFGRA Sbjct: 28 PRVSRTKGHLSKRTAFVRDIVKEVAGLAPYERRVVELLRNSKDKRARKLAKRRLGTFGRA 87 Query: 283 KAKVEELTNVIAESRRAGH 227 K KV+E+TN IAESRRAGH Sbjct: 88 KRKVDEMTNYIAESRRAGH 106 >ref|XP_011108925.1| hypothetical protein H072_2940 [Dactylellina haptotyla CBS 200.50] gi|526202759|gb|EPS43080.1| hypothetical protein H072_2940 [Dactylellina haptotyla CBS 200.50] Length = 104 Score = 110 bits (275), Expect = 4e-22 Identities = 57/78 (73%), Positives = 64/78 (82%) Frame = -1 Query: 460 RISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRAK 281 RISR+KGK SKRT FVREI +EV+GLAPYE+RVIEL+RNSKD LGTFGRAK Sbjct: 27 RISRTKGKLSKRTSFVREIAKEVAGLAPYEKRVIELIRNSKDKRARKLAKKRLGTFGRAK 86 Query: 280 AKVEELTNVIAESRRAGH 227 KV+ELTNVIAE+RRAGH Sbjct: 87 RKVDELTNVIAEARRAGH 104 >gb|KJZ73511.1| 60S ribosomal protein L36 [Hirsutella minnesotensis 3608] Length = 106 Score = 110 bits (274), Expect = 5e-22 Identities = 57/79 (72%), Positives = 63/79 (79%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PR+SR+KG SKRT FVRE+V+EV+GLAPYERRVIELLRNSKD LGTFGRA Sbjct: 28 PRVSRTKGHLSKRTSFVREVVKEVAGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRA 87 Query: 283 KAKVEELTNVIAESRRAGH 227 K KV+EL VIAESRRAGH Sbjct: 88 KKKVDELQRVIAESRRAGH 106 >gb|KIL94551.1| 60s ribosomal protein l36 [Fusarium avenaceum] Length = 106 Score = 110 bits (274), Expect = 5e-22 Identities = 57/79 (72%), Positives = 63/79 (79%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PR+SR+KG SKRT FVRE+V+EV+GLAPYERRVIELLRNSKD LGTFGRA Sbjct: 28 PRVSRTKGHLSKRTAFVREVVKEVAGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRA 87 Query: 283 KAKVEELTNVIAESRRAGH 227 KAKV+EL VIAESRR GH Sbjct: 88 KAKVDELQRVIAESRRTGH 106 >ref|XP_013341821.1| hypothetical protein AUEXF2481DRAFT_42094 [Aureobasidium subglaciale EXF-2481] gi|662536052|gb|KEQ93366.1| hypothetical protein AUEXF2481DRAFT_42094 [Aureobasidium subglaciale EXF-2481] Length = 106 Score = 110 bits (274), Expect = 5e-22 Identities = 55/79 (69%), Positives = 64/79 (81%) Frame = -1 Query: 463 PRISRSKGKASKRTQFVREIVEEVSGLAPYERRVIELLRNSKDXXXXXXXXXXLGTFGRA 284 PR+SR+KG SKRT FVR++V+EV+GLAPYERRV+ELLRNSKD LGTFGRA Sbjct: 28 PRVSRTKGHLSKRTAFVRDVVKEVAGLAPYERRVVELLRNSKDKRARKLAKRRLGTFGRA 87 Query: 283 KAKVEELTNVIAESRRAGH 227 K KV+E+TN IAESRRAGH Sbjct: 88 KRKVDEMTNYIAESRRAGH 106