BLASTX nr result
ID: Ophiopogon21_contig00043347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00043347 (419 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESA14170.1| hypothetical protein GLOINDRAFT_346639 [Rhizophag... 63 1e-07 >gb|ESA14170.1| hypothetical protein GLOINDRAFT_346639 [Rhizophagus irregularis DAOM 181602] gi|595437561|gb|EXX51763.1| hypothetical protein RirG_258890 [Rhizophagus irregularis DAOM 197198w] Length = 167 Score = 62.8 bits (151), Expect = 1e-07 Identities = 35/64 (54%), Positives = 42/64 (65%), Gaps = 3/64 (4%) Frame = -1 Query: 296 MRGASRGSWGQRENWREYGVRAR--RDEIGLR-GRGGVRGDWGIRGRERGEWNIRGRTSY 126 MRGASR + R++WREY +R R R+E+GLR GRGG WGIRGR+ EW Y Sbjct: 58 MRGASRITRSSRDSWREYSMRGRSLREEVGLRGGRGGRSEYWGIRGRDVREWR---SVPY 114 Query: 125 GELG 114 GELG Sbjct: 115 GELG 118