BLASTX nr result
ID: Ophiopogon21_contig00043333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00043333 (455 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIM27305.1| hypothetical protein M408DRAFT_330183 [Serendipit... 64 6e-08 emb|CCA67005.1| hypothetical protein PIIN_00842 [Piriformospora ... 60 8e-07 >gb|KIM27305.1| hypothetical protein M408DRAFT_330183 [Serendipita vermifera MAFF 305830] Length = 508 Score = 63.5 bits (153), Expect = 6e-08 Identities = 33/43 (76%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 137 MSILMSSMHSFSHYEPFNAASYSTALFDNQD-NYLQSAAFSPS 12 MSILM SM FSHY+P+NAASYSTALFD Q+ YL SAAFSPS Sbjct: 1 MSILMPSMPHFSHYDPYNAASYSTALFDPQEAAYLDSAAFSPS 43 >emb|CCA67005.1| hypothetical protein PIIN_00842 [Piriformospora indica DSM 11827] Length = 464 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = -1 Query: 137 MSILMSSMHSFSHYEPFNAASYSTALFDNQDNYLQSAAFSPSSYA 3 MSILM +MHS S ++PFNA +Y T LFD Q++Y AA+SP+ YA Sbjct: 1 MSILMPTMHSMSQFDPFNAQAYPTTLFDAQEHYFPHAAYSPTGYA 45