BLASTX nr result
ID: Ophiopogon21_contig00043233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00043233 (393 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KLU89354.1| hypothetical protein MAPG_08325 [Magnaporthiopsis... 78 2e-12 ref|XP_009217821.1| hypothetical protein GGTG_01786 [Gaeumannomy... 78 2e-12 ref|XP_007602964.1| hypothetical protein CFIO01_11450 [Colletotr... 74 3e-11 gb|EQB56939.1| hypothetical protein CGLO_03011 [Colletotrichum g... 74 4e-11 gb|ENH81114.1| hypothetical protein Cob_10145 [Colletotrichum or... 74 4e-11 ref|XP_007275127.1| hypothetical protein CGGC5_4593 [Colletotric... 74 4e-11 ref|XP_007794362.1| hypothetical protein UCREL1_6471 [Eutypa lat... 73 1e-10 gb|KDN66477.1| hypothetical protein CSUB01_00922 [Colletotrichum... 72 1e-10 ref|XP_008088921.1| hypothetical protein GLRG_00045 [Colletotric... 72 1e-10 gb|KOP47167.1| Uncharacterized protein MMYC01_G04017 [Madurella ... 72 2e-10 ref|XP_003655559.1| hypothetical protein THITE_2119379 [Thielavi... 72 2e-10 emb|CCF36812.1| hypothetical protein CH063_08294 [Colletotrichum... 70 6e-10 ref|XP_014174193.1| hypothetical protein CMQ_1639 [Grosmannia cl... 69 2e-09 ref|XP_003713915.1| hypothetical protein MGG_08888 [Magnaporthe ... 69 2e-09 ref|XP_007834750.1| hypothetical protein PFICI_07978 [Pestalotio... 68 2e-09 ref|XP_001907880.1| hypothetical protein [Podospora anserina S m... 68 3e-09 emb|CRJ98383.1| hypothetical protein BN1723_008686, partial [Ver... 67 4e-09 emb|CRK28189.1| hypothetical protein BN1708_015115 [Verticillium... 67 4e-09 emb|CRK30388.1| hypothetical protein BN1708_000918, partial [Ver... 67 4e-09 ref|XP_003003158.1| conserved hypothetical protein [Verticillium... 67 4e-09 >gb|KLU89354.1| hypothetical protein MAPG_08325 [Magnaporthiopsis poae ATCC 64411] Length = 342 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTTTM 286 PIP LPLPSMLA QCGVSVGYGGFGWDRYQEYTTTM Sbjct: 307 PIPQLPLPSMLAPQCGVSVGYGGFGWDRYQEYTTTM 342 >ref|XP_009217821.1| hypothetical protein GGTG_01786 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|402086914|gb|EJT81812.1| hypothetical protein GGTG_01786 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 342 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTTTM 286 PIP LPLPSMLA QCGVSVGYGGFGWDRYQEYTTTM Sbjct: 307 PIPQLPLPSMLAPQCGVSVGYGGFGWDRYQEYTTTM 342 >ref|XP_007602964.1| hypothetical protein CFIO01_11450 [Colletotrichum fioriniae PJ7] gi|588890728|gb|EXF73406.1| hypothetical protein CFIO01_11450 [Colletotrichum fioriniae PJ7] Length = 340 Score = 74.3 bits (181), Expect = 3e-11 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTTTM 286 PIP LPLPSM QCGVSVGYGGFGWDRYQEYTTTM Sbjct: 305 PIPALPLPSMFTPQCGVSVGYGGFGWDRYQEYTTTM 340 >gb|EQB56939.1| hypothetical protein CGLO_03011 [Colletotrichum gloeosporioides Cg-14] Length = 338 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTTTM 286 PIP LPLPSM QCGVS+GYGGFGWDRYQEYTTTM Sbjct: 303 PIPALPLPSMFTPQCGVSIGYGGFGWDRYQEYTTTM 338 >gb|ENH81114.1| hypothetical protein Cob_10145 [Colletotrichum orbiculare MAFF 240422] Length = 339 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTTTM 286 PIP LPLPSM QCGVS+GYGGFGWDRYQEYTTTM Sbjct: 304 PIPALPLPSMFTPQCGVSIGYGGFGWDRYQEYTTTM 339 >ref|XP_007275127.1| hypothetical protein CGGC5_4593 [Colletotrichum gloeosporioides Nara gc5] gi|429861091|gb|ELA35797.1| hypothetical protein CGGC5_4593 [Colletotrichum gloeosporioides Nara gc5] Length = 338 Score = 73.9 bits (180), Expect = 4e-11 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTTTM 286 PIP LPLPSM QCGVS+GYGGFGWDRYQEYTTTM Sbjct: 303 PIPALPLPSMFTPQCGVSIGYGGFGWDRYQEYTTTM 338 >ref|XP_007794362.1| hypothetical protein UCREL1_6471 [Eutypa lata UCREL1] gi|471566164|gb|EMR66542.1| hypothetical protein UCREL1_6471 [Eutypa lata UCREL1] Length = 342 Score = 72.8 bits (177), Expect = 1e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTTTM 286 PIP LPLPSMLA QCGVS+GYGG GWDRYQEYTT M Sbjct: 307 PIPSLPLPSMLAPQCGVSIGYGGLGWDRYQEYTTIM 342 >gb|KDN66477.1| hypothetical protein CSUB01_00922 [Colletotrichum sublineola] Length = 340 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/36 (86%), Positives = 31/36 (86%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTTTM 286 PIP LPLPSM QCGVSVGYGGFGWDRYQEY TTM Sbjct: 305 PIPALPLPSMFTPQCGVSVGYGGFGWDRYQEYATTM 340 >ref|XP_008088921.1| hypothetical protein GLRG_00045 [Colletotrichum graminicola M1.001] gi|310789368|gb|EFQ24901.1| hypothetical protein GLRG_00045 [Colletotrichum graminicola M1.001] Length = 340 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/36 (86%), Positives = 31/36 (86%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTTTM 286 PIP LPLPSM QCGVSVGYGGFGWDRYQEY TTM Sbjct: 305 PIPALPLPSMFTPQCGVSVGYGGFGWDRYQEYATTM 340 >gb|KOP47167.1| Uncharacterized protein MMYC01_G04017 [Madurella mycetomatis] Length = 343 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWD-RYQEYTTTM 286 P+PHLPLPSMLA QCGVSVGY FGWD RYQEYTTTM Sbjct: 307 PVPHLPLPSMLAPQCGVSVGYNSFGWDNRYQEYTTTM 343 >ref|XP_003655559.1| hypothetical protein THITE_2119379 [Thielavia terrestris NRRL 8126] gi|347002823|gb|AEO69223.1| hypothetical protein THITE_2119379 [Thielavia terrestris NRRL 8126] Length = 341 Score = 71.6 bits (174), Expect = 2e-10 Identities = 31/36 (86%), Positives = 31/36 (86%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTTTM 286 PIP LPLPSMLA QCGVSVGY FGWDRYQEY TTM Sbjct: 306 PIPQLPLPSMLAPQCGVSVGYNSFGWDRYQEYATTM 341 >emb|CCF36812.1| hypothetical protein CH063_08294 [Colletotrichum higginsianum] Length = 340 Score = 70.1 bits (170), Expect = 6e-10 Identities = 30/36 (83%), Positives = 30/36 (83%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTTTM 286 PIP LPLPSM QCGVSVGYG FGWDRYQEY TTM Sbjct: 305 PIPALPLPSMFTPQCGVSVGYGSFGWDRYQEYATTM 340 >ref|XP_014174193.1| hypothetical protein CMQ_1639 [Grosmannia clavigera kw1407] gi|320592272|gb|EFX04711.1| hypothetical protein CMQ_1639 [Grosmannia clavigera kw1407] Length = 365 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTTTM 286 P+P LPLPSMLA QCGVSVGY FGWDRY EYT TM Sbjct: 330 PLPQLPLPSMLAPQCGVSVGYNNFGWDRYHEYTPTM 365 >ref|XP_003713915.1| hypothetical protein MGG_08888 [Magnaporthe oryzae 70-15] gi|351646248|gb|EHA54108.1| hypothetical protein MGG_08888 [Magnaporthe oryzae 70-15] gi|440473237|gb|ELQ42052.1| hypothetical protein OOU_Y34scaffold00240g59 [Magnaporthe oryzae Y34] gi|440480223|gb|ELQ60898.1| hypothetical protein OOW_P131scaffold01214g14 [Magnaporthe oryzae P131] Length = 341 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTTTM 286 PIP L LPSM QCGV +GYGGFGWDRYQEYTTTM Sbjct: 306 PIPTLSLPSMFTPQCGVGMGYGGFGWDRYQEYTTTM 341 >ref|XP_007834750.1| hypothetical protein PFICI_07978 [Pestalotiopsis fici W106-1] gi|573060687|gb|ETS80449.1| hypothetical protein PFICI_07978 [Pestalotiopsis fici W106-1] Length = 342 Score = 68.2 bits (165), Expect = 2e-09 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTTTM 286 PIP LPLPSML + CG++ G+GGFGWDRYQEY TTM Sbjct: 307 PIPALPLPSMLTAHCGINTGFGGFGWDRYQEYATTM 342 >ref|XP_001907880.1| hypothetical protein [Podospora anserina S mat+] gi|170942900|emb|CAP68553.1| unnamed protein product [Podospora anserina S mat+] gi|681102569|emb|CDP32027.1| Putative protein of unknown function [Podospora anserina S mat+] Length = 344 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWD-RYQEYTTTM 286 PIPHLPLPSMLA QCGV+VGY FGWD RYQ+Y TTM Sbjct: 308 PIPHLPLPSMLAPQCGVTVGYNSFGWDSRYQDYATTM 344 >emb|CRJ98383.1| hypothetical protein BN1723_008686, partial [Verticillium longisporum] Length = 342 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTT 292 PIP LPLPSM A QCGV +GYGGFGWDRYQEY T Sbjct: 307 PIPALPLPSMFAPQCGVGMGYGGFGWDRYQEYAT 340 >emb|CRK28189.1| hypothetical protein BN1708_015115 [Verticillium longisporum] Length = 195 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTT 292 PIP LPLPSM A QCGV +GYGGFGWDRYQEY T Sbjct: 160 PIPALPLPSMFAPQCGVGMGYGGFGWDRYQEYAT 193 >emb|CRK30388.1| hypothetical protein BN1708_000918, partial [Verticillium longisporum] gi|913903640|emb|CRJ98364.1| hypothetical protein BN1723_008683, partial [Verticillium longisporum] Length = 342 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTT 292 PIP LPLPSM A QCGV +GYGGFGWDRYQEY T Sbjct: 307 PIPALPLPSMFAPQCGVGMGYGGFGWDRYQEYAT 340 >ref|XP_003003158.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] gi|261358182|gb|EEY20610.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] Length = 142 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 393 PIPHLPLPSMLASQCGVSVGYGGFGWDRYQEYTT 292 PIP LPLPSM A QCGV +GYGGFGWDRYQEY T Sbjct: 107 PIPALPLPSMFAPQCGVGMGYGGFGWDRYQEYAT 140