BLASTX nr result
ID: Ophiopogon21_contig00042929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042929 (339 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botry... 107 3e-21 ref|XP_008085508.1| Nucleic acid-binding protein [Glarea lozoyen... 107 4e-21 gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F... 106 8e-21 ref|XP_012743726.1| 40S ribosomal protein S28 [Pseudogymnoascus ... 106 8e-21 ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria trit... 106 8e-21 ref|XP_003650823.1| 40S ribosomal protein S28 [Thielavia terrest... 105 1e-20 ref|XP_001903978.1| hypothetical protein [Podospora anserina S m... 105 1e-20 ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfa... 105 2e-20 ref|XP_007681584.1| hypothetical protein BAUCODRAFT_315059 [Baud... 104 2e-20 ref|XP_001561242.1| 40S ribosomal protein S28 [Botrytis cinerea ... 104 2e-20 gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina M... 104 3e-20 ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marne... 103 4e-20 ref|XP_003664442.1| hypothetical protein MYCTH_36979, partial [M... 103 4e-20 gb|KDB13252.1| IBR domain-containing protein [Ustilaginoidea vir... 103 5e-20 ref|XP_003000163.1| 40S ribosomal protein S28 [Verticillium alfa... 103 5e-20 ref|XP_960561.1| 40S ribosomal protein S28 [Neurospora crassa OR... 103 5e-20 ref|XP_007915668.1| putative 40s ribosomal protein s28 protein [... 103 5e-20 gb|ERS99836.1| 40S ribosomal protein S28 [Sporothrix schenckii A... 102 9e-20 ref|XP_007779255.1| 40S ribosomal protein S28 [Coniosporium apol... 102 9e-20 ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [... 102 9e-20 >gb|EMR82428.1| putative 40s ribosomal protein s28 protein [Botrytis cinerea BcDW1] Length = 114 Score = 107 bits (268), Expect = 3e-21 Identities = 54/57 (94%), Positives = 56/57 (98%) Frame = -2 Query: 308 IANMDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 IA M++SKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 44 IAKMEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 100 >ref|XP_008085508.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] gi|512199315|gb|EPE28149.1| Nucleic acid-binding protein [Glarea lozoyensis ATCC 20868] gi|751749436|gb|KIM97619.1| hypothetical protein OIDMADRAFT_20164 [Oidiodendron maius Zn] Length = 68 Score = 107 bits (267), Expect = 4e-21 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >gb|ESZ95319.1| 40S ribosomal protein S28 [Sclerotinia borealis F-4157] Length = 68 Score = 106 bits (264), Expect = 8e-21 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 MD+SKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_012743726.1| 40S ribosomal protein S28 [Pseudogymnoascus destructans 20631-21] gi|440632220|gb|ELR02139.1| 40S ribosomal protein S28 [Pseudogymnoascus destructans 20631-21] Length = 68 Score = 106 bits (264), Expect = 8e-21 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 MD+SKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDTSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_003850653.1| 40S ribosomal protein S28 [Zymoseptoria tritici IPO323] gi|631388890|ref|XP_007928825.1| hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] gi|339470532|gb|EGP85629.1| hypothetical protein MYCGRDRAFT_81501 [Zymoseptoria tritici IPO323] gi|452980191|gb|EME79952.1| hypothetical protein MYCFIDRAFT_49708 [Pseudocercospora fijiensis CIRAD86] gi|752275464|dbj|GAM89234.1| hypothetical protein ANO11243_072710 [fungal sp. No.11243] gi|796706002|gb|KJX97506.1| 40s ribosomal protein s28 [Zymoseptoria brevis] Length = 68 Score = 106 bits (264), Expect = 8e-21 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 MDS+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_003650823.1| 40S ribosomal protein S28 [Thielavia terrestris NRRL 8126] gi|346998084|gb|AEO64487.1| hypothetical protein THITE_2110661, partial [Thielavia terrestris NRRL 8126] Length = 67 Score = 105 bits (263), Expect = 1e-20 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 MDSSK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_001903978.1| hypothetical protein [Podospora anserina S mat+] gi|170937097|emb|CAP61755.1| unnamed protein product [Podospora anserina S mat+] gi|681098209|emb|CDP28104.1| Putative cytosolic 40S ribosomal protein Rps28 [Podospora anserina S mat+] gi|923154208|gb|KOP48023.1| 40S ribosomal protein S28 [Madurella mycetomatis] Length = 68 Score = 105 bits (263), Expect = 1e-20 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 MDSSK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_003009124.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|697069809|ref|XP_009650088.1| hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] gi|261352270|gb|EEY14698.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|346970282|gb|EGY13734.1| hypothetical protein VDAG_00416 [Verticillium dahliae VdLs.17] gi|913765558|emb|CRK36463.1| hypothetical protein BN1708_007062 [Verticillium longisporum] gi|913796818|emb|CRK15241.1| hypothetical protein BN1708_011409 [Verticillium longisporum] gi|913900802|emb|CRK11466.1| hypothetical protein BN1723_001798 [Verticillium longisporum] Length = 68 Score = 105 bits (261), Expect = 2e-20 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_007681584.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia panamericana UAMH 10762] gi|918824268|ref|XP_013430056.1| ribosomal protein S28e [Aureobasidium namibiae CBS 147.97] gi|449295094|gb|EMC91116.1| hypothetical protein BAUCODRAFT_315059 [Baudoinia panamericana UAMH 10762] gi|662503260|gb|KEQ60881.1| ribosomal protein S28e [Aureobasidium melanogenum CBS 110374] gi|662518527|gb|KEQ76087.1| ribosomal protein S28e [Aureobasidium namibiae CBS 147.97] gi|662527623|gb|KEQ85002.1| ribosomal protein S28e [Aureobasidium pullulans EXF-150] Length = 68 Score = 104 bits (260), Expect = 2e-20 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 M+S+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >ref|XP_001561242.1| 40S ribosomal protein S28 [Botrytis cinerea B05.10] gi|347829972|emb|CCD45669.1| hypothetical protein BofuT4P34000010001 [Botrytis cinerea T4] Length = 68 Score = 104 bits (260), Expect = 2e-20 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 M++SKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 MEASKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 54 >gb|EKG14828.1| Ribosomal protein S28e [Macrophomina phaseolina MS6] gi|407924574|gb|EKG17607.1| Histone core [Macrophomina phaseolina MS6] gi|821064263|gb|KKY19538.1| putative 40s ribosomal protein s28 [Diplodia seriata] gi|821064801|gb|KKY20058.1| putative 40s ribosomal protein s28 [Diplodia seriata] Length = 68 Score = 104 bits (259), Expect = 3e-20 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 MDS+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 54 >ref|XP_002153086.1| 40S ribosomal protein S28 [Talaromyces marneffei ATCC 18224] gi|242820646|ref|XP_002487548.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] gi|242820650|ref|XP_002487549.1| 40S ribosomal protein S28 [Talaromyces stipitatus ATCC 10500] gi|210064606|gb|EEA18701.1| Ribosomal protein S28e [Talaromyces marneffei ATCC 18224] gi|218714013|gb|EED13437.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] gi|218714014|gb|EED13438.1| Ribosomal protein S28e [Talaromyces stipitatus ATCC 10500] gi|680000722|gb|KFX52824.1| 40S ribosomal protein S28 [Talaromyces marneffei PM1] gi|748550736|dbj|GAM43411.1| ribosomal protein [Talaromyces cellulolyticus] gi|816186318|emb|CRG91631.1| hypothetical protein PISL3812_08681 [Talaromyces islandicus] Length = 68 Score = 103 bits (258), Expect = 4e-20 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 MDS+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_003664442.1| hypothetical protein MYCTH_36979, partial [Myceliophthora thermophila ATCC 42464] gi|347011712|gb|AEO59197.1| hypothetical protein MYCTH_36979, partial [Myceliophthora thermophila ATCC 42464] Length = 64 Score = 103 bits (258), Expect = 4e-20 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = -2 Query: 296 DSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 DSSK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI Sbjct: 1 DSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 53 >gb|KDB13252.1| IBR domain-containing protein [Ustilaginoidea virens] Length = 480 Score = 103 bits (257), Expect = 5e-20 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 MDSSK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 413 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 466 >ref|XP_003000163.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|697076619|ref|XP_009652495.1| 40S ribosomal protein S28 [Verticillium dahliae VdLs.17] gi|261360820|gb|EEY23248.1| 40S ribosomal protein S28 [Verticillium alfalfae VaMs.102] gi|346979706|gb|EGY23158.1| 40S ribosomal protein S28 [Verticillium dahliae VdLs.17] gi|729185410|emb|CEJ91264.1| Putative 40S ribosomal protein S28 [Torrubiella hemipterigena] gi|913767874|emb|CRK34680.1| hypothetical protein BN1708_016348 [Verticillium longisporum] Length = 68 Score = 103 bits (257), Expect = 5e-20 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 MDSSK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSSKTPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_960561.1| 40S ribosomal protein S28 [Neurospora crassa OR74A] gi|336276482|ref|XP_003352994.1| 40S ribosomal protein S28 [Sordaria macrospora k-hell] gi|698994490|ref|XP_009854226.1| hypothetical protein NEUTE1DRAFT_118111 [Neurospora tetrasperma FGSC 2508] gi|51316762|sp|Q7S6W5.1|RS28_NEUCR RecName: Full=40S ribosomal protein S28 gi|28922054|gb|EAA31325.1| 40S ribosomal protein S28 [Neurospora crassa OR74A] gi|336466085|gb|EGO54250.1| hypothetical protein NEUTE1DRAFT_118111 [Neurospora tetrasperma FGSC 2508] gi|350287069|gb|EGZ68316.1| ribosomal protein S28e [Neurospora tetrasperma FGSC 2509] gi|380092479|emb|CCC09756.1| unnamed protein product [Sordaria macrospora k-hell] gi|725983750|gb|KHE86754.1| hypothetical protein GE21DRAFT_8916 [Neurospora crassa] Length = 68 Score = 103 bits (257), Expect = 5e-20 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 MDSSK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_007915668.1| putative 40s ribosomal protein s28 protein [Togninia minima UCRPA7] gi|953394942|ref|XP_014541713.1| Ribosomal protein S28e, partial [Metarhizium brunneum ARSEF 3297] gi|399165856|emb|CCE33319.1| probable ribosomal protein S28B [Claviceps purpurea 20.1] gi|500256292|gb|EON99563.1| putative 40s ribosomal protein s28 protein [Phaeoacremonium minimum UCRPA7] gi|594720915|gb|EXV03803.1| ribosomal protein S28e [Metarhizium robertsii] gi|672383491|gb|KFG85603.1| 40S ribosomal protein S28 [Metarhizium anisopliae] gi|743638615|gb|KID69986.1| Ribosomal protein S28e, partial [Metarhizium anisopliae ARSEF 549] gi|743641156|gb|KID72508.1| Ribosomal protein S28e, partial [Metarhizium brunneum ARSEF 3297] gi|743662232|gb|KID89430.1| Ribosomal protein S28e [Metarhizium guizhouense ARSEF 977] gi|770389641|gb|KJK75639.1| hypothetical protein H634G_09003 [Metarhizium anisopliae BRIP 53293] gi|770409186|gb|KJK93999.1| hypothetical protein H633G_02099 [Metarhizium anisopliae BRIP 53284] gi|799246995|gb|KJZ75767.1| 40S ribosomal protein S28 [Hirsutella minnesotensis 3608] Length = 68 Score = 103 bits (257), Expect = 5e-20 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 MDSSK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSSKAPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >gb|ERS99836.1| 40S ribosomal protein S28 [Sporothrix schenckii ATCC 58251] gi|748541462|gb|KIH91767.1| small subunit ribosomal protein S28e [Sporothrix brasiliensis 5110] gi|751356805|gb|KIL94527.1| 40s ribosomal protein s28 [Fusarium avenaceum] gi|780595120|gb|KJR85779.1| small subunit ribosomal protein S28e [Sporothrix schenckii 1099-18] Length = 68 Score = 102 bits (255), Expect = 9e-20 Identities = 52/54 (96%), Positives = 52/54 (96%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 MDSSK PVKLVKVTRVLGRTGSRGGVTQVRVEFMDD TRSIIRNVKGPVREDDI Sbjct: 1 MDSSKQPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDQTRSIIRNVKGPVREDDI 54 >ref|XP_007779255.1| 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] gi|494826922|gb|EON63938.1| 40S ribosomal protein S28 [Coniosporium apollinis CBS 100218] Length = 68 Score = 102 bits (255), Expect = 9e-20 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 MDS+KVPVKLVKVTRVLGRTGSRGGV+QVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 1 MDSAKVPVKLVKVTRVLGRTGSRGGVSQVRVEFMDDTTRSIIRNVKGPVRENDI 54 >ref|XP_007582595.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|615415585|ref|XP_007584949.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485922014|gb|EOD47615.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] gi|485925270|gb|EOD49893.1| putative 40s ribosomal protein s28 protein [Neofusicoccum parvum UCRNP2] Length = 68 Score = 102 bits (255), Expect = 9e-20 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -2 Query: 299 MDSSKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVREDDI 138 M+S+KVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRE+DI Sbjct: 1 MESAKVPVKLVKVTRVLGRTGSRGGVTQVRVEFMDDTTRSIIRNVKGPVRENDI 54