BLASTX nr result
ID: Ophiopogon21_contig00042875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042875 (492 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESA12130.1| hypothetical protein GLOINDRAFT_347515 [Rhizophag... 137 3e-30 >gb|ESA12130.1| hypothetical protein GLOINDRAFT_347515 [Rhizophagus irregularis DAOM 181602] gi|595461458|gb|EXX63693.1| hypothetical protein RirG_149920 [Rhizophagus irregularis DAOM 197198w] Length = 235 Score = 137 bits (345), Expect = 3e-30 Identities = 70/83 (84%), Positives = 72/83 (86%) Frame = -3 Query: 490 QLTAIINITFTXXXXXXXXXXXAQTITGDTGMRVLLAFTGSVIVGVAETFLYMRYLTGYD 311 QLTAI+NITFT AQTITGDTGMRVLLAFTGSVIVGVAETFLYMRYLTGYD Sbjct: 140 QLTAIVNITFTVVAVFAAVYHVAQTITGDTGMRVLLAFTGSVIVGVAETFLYMRYLTGYD 199 Query: 310 KDDTKERKPRRRSTTSGYHNKAA 242 KDDTKERKPRRRSTT+GYHNKAA Sbjct: 200 KDDTKERKPRRRSTTTGYHNKAA 222