BLASTX nr result
ID: Ophiopogon21_contig00042846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042846 (395 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA71339.1| hypothetical protein PIIN_05278 [Piriformospora ... 60 6e-07 >emb|CCA71339.1| hypothetical protein PIIN_05278 [Piriformospora indica DSM 11827] Length = 174 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 2/52 (3%) Frame = -1 Query: 392 GLALCVAQTVVAPPIPPGFFNHNNTGAVDWTPVSPGDD--GYDDSLPFCDEV 243 GL LCVA TVVAPPIPPGFF +N G+++W P +P D D +P+CDEV Sbjct: 123 GLVLCVAPTVVAPPIPPGFF--DNDGSIEWVP-TPDDQITEEDGDVPYCDEV 171