BLASTX nr result
ID: Ophiopogon21_contig00042832
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042832 (401 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007915172.1| putative calcipressin family protein [Tognin... 71 4e-10 gb|KDB19102.1| Calcipressin family protein [Ustilaginoidea viren... 65 2e-08 emb|CCE30407.1| related to inhibitor of calcineurin [Claviceps p... 65 2e-08 gb|KND94093.1| Calcipressin-1 [Tolypocladium ophioglossoides CBS... 63 8e-08 emb|CEJ91604.1| Putative Calcipressin-like protein [Torrubiella ... 63 8e-08 ref|XP_008596404.1| calcipressin -like protein [Beauveria bassia... 63 1e-07 ref|XP_013944632.1| hypothetical protein TRIATDRAFT_299076 [Tric... 63 1e-07 ref|XP_006669633.1| calcineurin binding protein, putative [Cordy... 63 1e-07 gb|EQK99594.1| calcipressin [Ophiocordyceps sinensis CO18] 62 1e-07 gb|KJK81554.1| hypothetical protein H634G_02814 [Metarhizium ani... 62 2e-07 ref|XP_014583016.1| Calcipressin family protein, partial [Metarh... 62 2e-07 gb|KID88554.1| Calcipressin family protein [Metarhizium guizhoue... 62 2e-07 ref|XP_014543346.1| Calcipressin family protein, partial [Metarh... 62 2e-07 gb|KFG82912.1| Calcipressin family protein [Metarhizium anisopli... 62 2e-07 ref|XP_001228347.1| hypothetical protein CHGG_10420 [Chaetomium ... 62 2e-07 ref|XP_006966140.1| predicted protein [Trichoderma reesei QM6a] ... 62 2e-07 ref|XP_007817988.1| calcipressin [Metarhizium robertsii ARSEF 23... 62 2e-07 ref|XP_007806391.1| Calcipressin family protein [Metarhizium acr... 62 2e-07 gb|KOS22624.1| Calcipressin-1 [Escovopsis weberi] 61 3e-07 gb|KKO96760.1| calcipressin [Trichoderma harzianum] 61 3e-07 >ref|XP_007915172.1| putative calcipressin family protein [Togninia minima UCRPA7] gi|500256770|gb|EOO00011.1| putative calcipressin family protein [Phaeoacremonium minimum UCRPA7] Length = 256 Score = 70.9 bits (172), Expect = 4e-10 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIFR 3 K SLTLDLSNLPPLIQPTPPSNTLLFTNLQ LDIFR Sbjct: 21 KKSLTLDLSNLPPLIQPTPPSNTLLFTNLQELDIFR 56 >gb|KDB19102.1| Calcipressin family protein [Ustilaginoidea virens] gi|781084823|dbj|GAO16519.1| hypothetical protein UVI_038070 [Ustilaginoidea virens] Length = 254 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIFR 3 K +LTLDLSNLPPL+QPTPPSNTLLFT L +LDIFR Sbjct: 16 KSNLTLDLSNLPPLVQPTPPSNTLLFTGLNNLDIFR 51 >emb|CCE30407.1| related to inhibitor of calcineurin [Claviceps purpurea 20.1] Length = 253 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIFR 3 K +LTLDLSNLPPL+QPTPPSNTLLFT L +LDIFR Sbjct: 17 KTNLTLDLSNLPPLVQPTPPSNTLLFTGLNNLDIFR 52 >gb|KND94093.1| Calcipressin-1 [Tolypocladium ophioglossoides CBS 100239] Length = 254 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 107 HSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIFR 3 ++LTLDLSNLPPL QPTPPSNTLLFTNL + DIFR Sbjct: 19 NNLTLDLSNLPPLTQPTPPSNTLLFTNLNNTDIFR 53 >emb|CEJ91604.1| Putative Calcipressin-like protein [Torrubiella hemipterigena] Length = 252 Score = 63.2 bits (152), Expect = 8e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIF 6 K +LTLDLSNLPPLI PTPPSNTLLFTNL +LDIF Sbjct: 18 KANLTLDLSNLPPLILPTPPSNTLLFTNLDNLDIF 52 >ref|XP_008596404.1| calcipressin -like protein [Beauveria bassiana ARSEF 2860] gi|400600515|gb|EJP68189.1| calcipressin -like protein [Beauveria bassiana ARSEF 2860] gi|701772614|gb|KGQ07177.1| Calcipressin-2 [Beauveria bassiana D1-5] Length = 259 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 104 SLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIFR 3 +LTLDLSNLPPL QPTPPSNTLLFTNL ++DIFR Sbjct: 20 NLTLDLSNLPPLEQPTPPSNTLLFTNLDNVDIFR 53 >ref|XP_013944632.1| hypothetical protein TRIATDRAFT_299076 [Trichoderma atroviride IMI 206040] gi|358397033|gb|EHK46408.1| hypothetical protein TRIATDRAFT_299076 [Trichoderma atroviride IMI 206040] Length = 253 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIF 6 K +L+LDLS+LPPLIQPTPPSNTLLFTNL +LDIF Sbjct: 18 KSNLSLDLSDLPPLIQPTPPSNTLLFTNLNNLDIF 52 >ref|XP_006669633.1| calcineurin binding protein, putative [Cordyceps militaris CM01] gi|346323452|gb|EGX93050.1| calcineurin binding protein, putative [Cordyceps militaris CM01] Length = 258 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 104 SLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIFR 3 +LTLDLSNLPPL QPTPPSNTLLFTNL ++DIFR Sbjct: 20 NLTLDLSNLPPLEQPTPPSNTLLFTNLDNVDIFR 53 >gb|EQK99594.1| calcipressin [Ophiocordyceps sinensis CO18] Length = 251 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIFR 3 K +LTLDLSNLPP QPTPPSNTLLFTNL ++DIFR Sbjct: 17 KANLTLDLSNLPPPTQPTPPSNTLLFTNLNNIDIFR 52 >gb|KJK81554.1| hypothetical protein H634G_02814 [Metarhizium anisopliae BRIP 53293] gi|770407090|gb|KJK91953.1| hypothetical protein H633G_04168 [Metarhizium anisopliae BRIP 53284] Length = 252 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIFR 3 K LTLDLSNLPPL QPTPPSNTLLFT L + DIFR Sbjct: 17 KSGLTLDLSNLPPLTQPTPPSNTLLFTGLNNTDIFR 52 >ref|XP_014583016.1| Calcipressin family protein, partial [Metarhizium majus ARSEF 297] gi|743677110|gb|KIE04023.1| Calcipressin family protein, partial [Metarhizium majus ARSEF 297] Length = 252 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIFR 3 K LTLDLSNLPPL QPTPPSNTLLFT L + DIFR Sbjct: 17 KSGLTLDLSNLPPLTQPTPPSNTLLFTGLNNTDIFR 52 >gb|KID88554.1| Calcipressin family protein [Metarhizium guizhouense ARSEF 977] Length = 252 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIFR 3 K LTLDLSNLPPL QPTPPSNTLLFT L + DIFR Sbjct: 17 KSGLTLDLSNLPPLTQPTPPSNTLLFTGLNNTDIFR 52 >ref|XP_014543346.1| Calcipressin family protein, partial [Metarhizium brunneum ARSEF 3297] gi|743642871|gb|KID74153.1| Calcipressin family protein, partial [Metarhizium brunneum ARSEF 3297] Length = 252 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIFR 3 K LTLDLSNLPPL QPTPPSNTLLFT L + DIFR Sbjct: 17 KSGLTLDLSNLPPLTQPTPPSNTLLFTGLNNTDIFR 52 >gb|KFG82912.1| Calcipressin family protein [Metarhizium anisopliae] gi|743635793|gb|KID67173.1| Calcipressin family protein, partial [Metarhizium anisopliae ARSEF 549] Length = 252 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIFR 3 K LTLDLSNLPPL QPTPPSNTLLFT L + DIFR Sbjct: 17 KSGLTLDLSNLPPLTQPTPPSNTLLFTGLNNTDIFR 52 >ref|XP_001228347.1| hypothetical protein CHGG_10420 [Chaetomium globosum CBS 148.51] gi|88176548|gb|EAQ84016.1| hypothetical protein CHGG_10420 [Chaetomium globosum CBS 148.51] Length = 289 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIF 6 K +LTLDL+NLPPLI+PTPP NTL+FTNLQS DIF Sbjct: 43 KSTLTLDLANLPPLIKPTPPCNTLIFTNLQSRDIF 77 >ref|XP_006966140.1| predicted protein [Trichoderma reesei QM6a] gi|340517854|gb|EGR48097.1| predicted protein [Trichoderma reesei QM6a] gi|572278974|gb|ETS02125.1| Calcipressin family protein [Trichoderma reesei RUT C-30] Length = 252 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIF 6 K +L+LDLSNLPPL+QPTPPSNTL+FTNL + DIF Sbjct: 18 KSNLSLDLSNLPPLVQPTPPSNTLIFTNLNNTDIF 52 >ref|XP_007817988.1| calcipressin [Metarhizium robertsii ARSEF 23] gi|322710643|gb|EFZ02217.1| calcipressin [Metarhizium robertsii ARSEF 23] gi|594722504|gb|EXV05390.1| calcipressin domain protein [Metarhizium robertsii] Length = 252 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIFR 3 K LTLDLSNLPPL QPTPPSNTLLFT L + DIFR Sbjct: 17 KSGLTLDLSNLPPLTQPTPPSNTLLFTGLNNTDIFR 52 >ref|XP_007806391.1| Calcipressin family protein [Metarhizium acridum CQMa 102] gi|322701812|gb|EFY93560.1| Calcipressin family protein [Metarhizium acridum CQMa 102] Length = 252 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIFR 3 K LTLDLSNLPPL QPTPPSNTLLFT L + DIFR Sbjct: 17 KSGLTLDLSNLPPLTQPTPPSNTLLFTGLNNTDIFR 52 >gb|KOS22624.1| Calcipressin-1 [Escovopsis weberi] Length = 257 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIF 6 K +L+LDLSNLPPL+QPTPPSNTLLFT L +LDIF Sbjct: 18 KVNLSLDLSNLPPLVQPTPPSNTLLFTGLNNLDIF 52 >gb|KKO96760.1| calcipressin [Trichoderma harzianum] Length = 252 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 110 KHSLTLDLSNLPPLIQPTPPSNTLLFTNLQSLDIF 6 K +L+LDLSNLPPL+QPTPPSNTL+FTNL + DIF Sbjct: 17 KANLSLDLSNLPPLVQPTPPSNTLIFTNLNNTDIF 51