BLASTX nr result
ID: Ophiopogon21_contig00042741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042741 (389 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007736749.1| hypothetical protein A1O3_08461 [Capronia ep... 56 9e-06 >ref|XP_007736749.1| hypothetical protein A1O3_08461 [Capronia epimyces CBS 606.96] gi|590003746|gb|EXJ78961.1| hypothetical protein A1O3_08461 [Capronia epimyces CBS 606.96] Length = 689 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -2 Query: 97 MADQLNMNGLSLNDSRHAPNGSINGGRSAYIP 2 MAD LN+NGLSLNDS+HAP G + GGRSAYIP Sbjct: 1 MADSLNLNGLSLNDSKHAPQGPMIGGRSAYIP 32