BLASTX nr result
ID: Ophiopogon21_contig00042693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042693 (345 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIO31062.1| hypothetical protein M407DRAFT_19938 [Tulasnella ... 88 2e-15 >gb|KIO31062.1| hypothetical protein M407DRAFT_19938 [Tulasnella calospora MUT 4182] Length = 83 Score = 88.2 bits (217), Expect = 2e-15 Identities = 43/56 (76%), Positives = 51/56 (91%) Frame = -3 Query: 169 MEAAIAQVLGATQDMTKDSTALARRDHASEFAGQRADPSEIATNIGIIITVAIVFS 2 ME+A+A +LGA QD+TK+ST LARR H +EFAGQRA+PSEIATNIGIIITVA+VFS Sbjct: 1 MESALASILGAAQDVTKNSTTLARRAHDAEFAGQRAEPSEIATNIGIIITVAVVFS 56