BLASTX nr result
ID: Ophiopogon21_contig00042691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon21_contig00042691 (565 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX54703.1| hypothetical protein RirG_232000 [Rhizophagus irr... 70 5e-10 gb|EXX54701.1| hypothetical protein RirG_232000 [Rhizophagus irr... 70 5e-10 gb|EXX54700.1| hypothetical protein RirG_232000 [Rhizophagus irr... 70 5e-10 gb|ESA13376.1| hypothetical protein GLOINDRAFT_346967, partial [... 70 5e-10 >gb|EXX54703.1| hypothetical protein RirG_232000 [Rhizophagus irregularis DAOM 197198w] Length = 446 Score = 70.5 bits (171), Expect = 5e-10 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -2 Query: 564 YDQSSNTQPDASKTSSLQQNPSSSMIPSPSTANISPDSSNVLPPLSEVF 418 YDQS+ T D SK SSLQQNP+SSMIPS +TAN+SPD SNVLPPLSEVF Sbjct: 105 YDQSTGT--DGSKASSLQQNPASSMIPSTTTANLSPD-SNVLPPLSEVF 150 >gb|EXX54701.1| hypothetical protein RirG_232000 [Rhizophagus irregularis DAOM 197198w] Length = 358 Score = 70.5 bits (171), Expect = 5e-10 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -2 Query: 564 YDQSSNTQPDASKTSSLQQNPSSSMIPSPSTANISPDSSNVLPPLSEVF 418 YDQS+ T D SK SSLQQNP+SSMIPS +TAN+SPD SNVLPPLSEVF Sbjct: 17 YDQSTGT--DGSKASSLQQNPASSMIPSTTTANLSPD-SNVLPPLSEVF 62 >gb|EXX54700.1| hypothetical protein RirG_232000 [Rhizophagus irregularis DAOM 197198w] Length = 397 Score = 70.5 bits (171), Expect = 5e-10 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -2 Query: 564 YDQSSNTQPDASKTSSLQQNPSSSMIPSPSTANISPDSSNVLPPLSEVF 418 YDQS+ T D SK SSLQQNP+SSMIPS +TAN+SPD SNVLPPLSEVF Sbjct: 56 YDQSTGT--DGSKASSLQQNPASSMIPSTTTANLSPD-SNVLPPLSEVF 101 >gb|ESA13376.1| hypothetical protein GLOINDRAFT_346967, partial [Rhizophagus irregularis DAOM 181602] Length = 139 Score = 70.5 bits (171), Expect = 5e-10 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -2 Query: 564 YDQSSNTQPDASKTSSLQQNPSSSMIPSPSTANISPDSSNVLPPLSEVF 418 YDQS+ T D SK SSLQQNP+SSMIPS +TAN+SPD SNVLPPLSEVF Sbjct: 56 YDQSTGT--DGSKASSLQQNPASSMIPSTTTANLSPD-SNVLPPLSEVF 101